Molecule Information
      General Information of the Molecule (ID: Mol00873)
  
  | Name | Chloramphenicol acetyltransferase (CAT)
                                ,Enterococcus faecalis
                               | ||||
|---|---|---|---|---|---|
| Synonyms | CGZ46_14915; EY666_15625     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | catA | ||||
| Sequence | MTFNIINLETWDRKEYFNHYFNQQTTFSVTKEFDITLLKSMIKNKGYKLYPALIYIIVNI INQNKVFRTGINSEGNLGYWDKLNPLYTVFNKETEKFSNIWTESNVSFNSFYNSYKSDLL EYKDKNEMFPKKPIPENTVPISMIPWIDFSSFNLNIGNNSRFLLPIITMGKFYSKNNKIY LPVSLQVHHAVCDGYHASLFMSEFQNMVDSVNEWI     Click to Show/Hide | ||||
| Function | This enzyme is an effector of chloramphenicol resistance in bacteria.     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Enterococcus faecalis infection | [1] | |||
| Resistant Disease | Enterococcus faecalis infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Enterococcus faecalis JH2-2 | 1351 | ||
| Escherichia coli strain XL-1 Blue | 562 | |||
| Enterococcus faecalis ESP91 | 1351 | |||
| Enterococcus faecalis FO1 | 1351 | |||
| Enterococcus faecalis FO5 | 1351 | |||
| Enterococcus faecalis JHBURE16-1 | 1351 | |||
| Enterococcus faecalis JHBURE16-2 | 1351 | |||
| Enterococcus faecalis JHBURE16-3 | 1351 | |||
| Enterococcus faecalis JHBURE8-1 | 1351 | |||
| Enterococcus faecalis JHBURE8-2 | 1351 | |||
| Enterococcus faecalis JHBURE8-3 | 1351 | |||
| Enterococcus faecalis JHRE25-2 | 1351 | |||
| Enterococcus faecalis JHRE25-3 | 1351 | |||
| Enterococcus faecalis RE17 | 1351 | |||
| Enterococcus faecalis RE25 | 1351 | |||
| Enterococcus faecalis RE38 | 1351 | |||
| Enterococcus faecalis RE44 | 1351 | |||
| Enterococcus faecalis RE52 | 1351 | |||
| Enterococcus faecium FI1 | 1352 | |||
| Escherichia coli CM1 | CM25 | |||
| Escherichia coli CM2 | CM25 | |||
| Escherichia coli CM25 | 562 | |||
| Lactococcus lactis susp. cremoris AC1 | 1359 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis Bu2-60 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis Bu2-60/pAMb1 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis Bu2-60/pIP501 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis Bu2-60/pRE39 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis BURE25-11 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis BURE25-12 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis BURE25-15 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis BURE25-16 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis BURE25-3 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis BURE25-6 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis BURE25-7 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis BURE25-8 | 44688 | |||
| Lactococcus lactis susp. lactis biovar. diacetylactis BURE25-9 | 44688 | |||
| Listeria innocua L19 | 1642 | |||
| Listeria innocua L191 | 1642 | |||
| Listeria innocua L193 | 1642 | |||
| Staphylococcus xylosus strains VF5 | 1288 | |||
| Experiment for Molecule Alteration | DNA hybridizations assay | |||
| Experiment for Drug Resistance | Microdilution test assay | |||
| Mechanism Description | Two antibiotic-resistance genes are present on this 30.5-kb region, a chloramphenicol acetyltransferase gene (orf10) and a 23S rRNA methyltransferase gene (orf14). Both genes have been shown to be active in E. faecalis RE25 and in its transconjugants. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
