Molecule Information

General Information of the Molecule (ID: Mol00871)

• Name: Chloramphenicol acetyltransferase (CAT) ,Proteus mirabilis
• Synonyms: CEP63_016285
• Molecule Type: Protein
• Gene Name: catA
• Sequence:
  MNYEKINLEQWNRKEHFLHYRHNLQCGFSLTTKIDITVLKTVLAKNNLKLYPAMIYLIAK
  TVNSYSESRMAIKDDELVIWDYINPVYTIFHPETETFSELWSEYVEDWHSFLEGYNQDYQ
  KYKDNLSLSAKSNFPENHFCISMIPWISFDGFNLNVANVKDYFPPIFTMGKYTQQSDNFL
  LPISIQVHHATCDGFHIARMINKLQELCDGFSG
• Function: This enzyme is an effector of chloramphenicol resistance in bacteria.
• Uniprot ID: A0A2J9LAW3_PROMI

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces actuosus

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Proteus mirabilis infection [1]

• Resistant Disease: Proteus mirabilis infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli strain JM103; 83333
• In Vitro Model: Proteus mirabilis strain PM13; 584
• In Vitro Model: Proteus mirabilis strain PM2; 584
• Experiment for Molecule Alteration: RNA-DNA hybridizations assay
• Mechanism Description: In Proteus mirabilis PM13 chloramphenicol resistance is mediated by the cat gene, a single copy of which is present in both resistant and sensitive isolates and which reverts at a high frequency. RNA measurements show an about 8.5-fold increase in cat-specific mRNA in cells expressing the resistance phenotype as compared with those which are sensitive to chloramphenicol.

References

• Ref 1: Nucleotide sequence analysis of the cat gene of Proteus mirabilis: comparison with the type I (Tn9) cat gene. J Bacteriol. 1985 Oct;164(1):123-9. doi: 10.1128/jb.164.1.123-129.1985.