Molecule Information

General Information of the Molecule (ID: Mol00871)

Name	Chloramphenicol acetyltransferase (CAT) ,Proteus mirabilis
Synonyms	CEP63_016285 Click to Show/Hide
Molecule Type	Protein
Gene Name	catA
Sequence	MNYEKINLEQWNRKEHFLHYRHNLQCGFSLTTKIDITVLKTVLAKNNLKLYPAMIYLIAK TVNSYSESRMAIKDDELVIWDYINPVYTIFHPETETFSELWSEYVEDWHSFLEGYNQDYQ KYKDNLSLSAKSNFPENHFCISMIPWISFDGFNLNVANVKDYFPPIFTMGKYTQQSDNFL LPISIQVHHATCDGFHIARMINKLQELCDGFSG Click to Show/Hide
Function	This enzyme is an effector of chloramphenicol resistance in bacteria. Click to Show/Hide
Uniprot ID	A0A2J9LAW3_PROMI
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Actinobacteria Class: Actinomycetia Order: Streptomycetales Family: Streptomycetaceae Genus: Streptomyces Species: Streptomyces actuosus

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Chloramphenicol

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Proteus mirabilis infection [ICD-11: 1A00-1C4Z]			[1]
Resistant Disease	Proteus mirabilis infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Chloramphenicol		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli strain JM103		83333
	Proteus mirabilis strain PM13		584
	Proteus mirabilis strain PM2		584
Experiment for Molecule Alteration	RNA-DNA hybridizations assay
Mechanism Description	In Proteus mirabilis PM13 chloramphenicol resistance is mediated by the cat gene, a single copy of which is present in both resistant and sensitive isolates and which reverts at a high frequency. RNA measurements show an about 8.5-fold increase in cat-specific mRNA in cells expressing the resistance phenotype as compared with those which are sensitive to chloramphenicol.

References

Ref 1	Nucleotide sequence analysis of the cat gene of Proteus mirabilis: comparison with the type I (Tn9) cat gene. J Bacteriol. 1985 Oct;164(1):123-9. doi: 10.1128/jb.164.1.123-129.1985.