Molecule Information
      General Information of the Molecule (ID: Mol00870)
  
  | Name | Chloramphenicol acetyltransferase (CAT)
                                ,Bacillus pumilus
                               | ||||
|---|---|---|---|---|---|
| Synonyms | CAT; Cat-86     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | cat86 | ||||
| Sequence | MFKQIDENYLRKEHFHHYMTLTRCSYSLVINLDITKLHAILKEKKLKVYPVQIYLLARAV QKIPEFRMDQVNDELGYWEILHPSYTILNKETKTFSSIWTPFDENFAQFYKSCVADIETF SKSSNLFPKPHMPENMFNISSLPWIDFTSFNLNVSTDEAYLLPIFTIGKFKVEEGKIILP VAIQVHHAVCDGYHAGQYVEYLRWLIEHCDEWLNDSLHIT     Click to Show/Hide | ||||
| Function | This enzyme is an effector of chloramphenicol resistance in bacteria.     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacillus pumilus infection | [1] | |||
| Resistant Disease | Bacillus pumilus infection [ICD-11: 1C4Y.3] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Bacillus pumilus strain NCIB8600 | 1408 | ||
| Bacillus subtilis strain BR151 | 1423 | |||
| Experiment for Molecule Alteration | Restriction enzyme assay | |||
| Mechanism Description | Genes (cat) specifying the enzyme CAT occur in a wide range of unrelated bacteria, where they confer resistance to the antibiotic Cm. Gene cat-86 of Bacillus pumilus, specifying chloramphenicol-inducible chloramphenicol acetyltransferase, was previously cloned in Bacillus subtilis on plasmid pUB110. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
