Molecule Information

General Information of the Molecule (ID: Mol00869)

• Name: Chloramphenicol acetyltransferase (CAT) ,Campylobacter coli
• Synonyms: CAT
• Molecule Type: Protein
• Gene Name: CAT
• Sequence:
  MQFTKIDINNWTRKEYFDHYFGNTPCTYSMTVKLDISKLKKDGKKLYPTLLYGVTTIINR
  HEEFRTALDENGQVGVFSEMLPCYTVFHKETETFSSIWTEFTADYTEFLQNYQKDIDAFG
  ERMGMSAKPNPPENTFPVSMIPWTSFEGFNLNLKKGYDYLLPIFTFGKYYEEGGKYYIPL
  SIQVHHAVCDGFHVCRFLDELQDLLNK
• Function: This enzyme is an effector of chloramphenicol resistance in bacteria.
• Uniprot ID: CAT_CAMCO

Kingdom: N.A.
Phylum: Proteobacteria
Class: Epsilonproteobacteria
Order: Campylobacterales
Family: Campylobacteraceae
Genus: Campylobacter
Species: Campylobacter coli

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Campylobacter fetus infection [1]

• Resistant Disease: Campylobacter fetus infection [ICD-11: 1C40.0]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Campylobacter coli strain UA585; 195
• In Vitro Model: Escherichia coli strain JM 107; 562
• Mechanism Description: A chloramphenicol-resistance determinant (CmR), originally cloned from Campylobacter coli plasmid pNR9589 in Japan, was isolated and the nucleotide sequence determined, which contained an open reading frame of 621 bp. The gene product was identified as Cm acetyltransferase (CAT), which had a putative amino acid sequence that showed 43% to 57% identity with other CAT proteins of both Gram+ and Gram- origin.

References

• Ref 1: Chloramphenicol resistance in Campylobacter coli: nucleotide sequence, expression, and cloning vector construction. Gene. 1990 Sep 28;94(1):23-8. doi: 10.1016/0378-1119(90)90463-2.