Molecule Information
General Information of the Molecule (ID: Mol00867)
Name |
Chloramphenicol acetyltransferase (CAT)
,Staphylococcus intermedius
|
||||
---|---|---|---|---|---|
Synonyms |
CAT
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
cat
|
||||
Sequence |
MTFNIIKLENWDRKEYFEHYFNQQTTYSITKEIDITLFKDMIKKKGYEIYPSLIYAIMEV
VNKNKVFRTGINSENKLGYWDKLNPLYTVFNKQTEKFTNIWTESDNNFTSFYNNYKNDLF EYKDKEEMFPKKPIPENTIPISMIPWIDFSSFNLNIGNNSSFLLPIITIGKFYSENNKIY IPVALQLHHAVCDGYHASLFINEFQDIIKKVDDWI Click to Show/Hide
|
||||
Function |
This enzyme is an effector of chloramphenicol resistance in bacteria.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Staphylococcus intermedius infection | [1] | |||
Resistant Disease | Staphylococcus intermedius infection [ICD-11: 1B54.3] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli strain XL-1 Blue | 562 | ||
A Staphylococcus intermedius strain isolated from a purulent skin infection of a dog | 1285 | |||
Experiment for Molecule Alteration |
Dideoxy chain-termination method assay | |||
Mechanism Description | However, little is known about CmR in staphylococcal species pathogenic to animals. Recently, CmR plasmids have been isolated from 'equine's. sciuri, 'canine' S. epidermidis, 'porcine' S. hyicus and 'canine' S. intermedius strains. All staphy- lococcal CmR plasmids encode a common resistance mechanism, namely an inducible Cm acetyltransferase (CAT). | |||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli strain XL-1 Blue | 562 | ||
A Staphylococcus intermedius strain isolated from a purulent skin infection of a dog | 1285 | |||
Experiment for Molecule Alteration |
Dideoxy chain-termination method assay | |||
Mechanism Description | Subsequently, Escherichia coli XL-1 blue cells transformed with these recombinant plasmids were tested for CmR. In one orientation, Escherichia coli XL-1 blue demonstrated CmR at 15 ug/ml Cm while in the other orientation a higher level of CmR occurred (80 ug/m Cm). |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.