Molecule Information
General Information of the Molecule (ID: Mol00864)
Name |
Chloramphenicol acetyltransferase (CAT)
,Agrobacterium tumefaciens
|
||||
---|---|---|---|---|---|
Synonyms |
Atu4738; AGR_L_286
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
cat
|
||||
Sequence |
MENYFESPFRGITLDKQVKSPNLVVGKYSYYSGYYHGHSFEDCARYLLPDEGADRLVIGS
FCSIGSGAAFIMAGNQGHRNEWISTFPFFFMPEVPEFENAANGYLPAGDTVIGNDVWIGS EAIIMPGITVGDGAVIGTRALVTKDVEPYAIVGGNPAKTIRKRFDDDSIALLLEMKWWGW PAERLKAAMPLMTSGNVAALYRFWRSDSL Click to Show/Hide
|
||||
Function |
This enzyme is an effector of chloramphenicol resistance in bacteria.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Agvobactevitlm tumefuciens infection | [1] | |||
Resistant Disease | Agvobactevitlm tumefuciens infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Agrobacterium tumefaciens strain C58 | 358 | ||
Escherichia coli strain JM101 | 83333 | |||
Experiment for Molecule Alteration |
Enzyme assay | |||
Mechanism Description | The nucleotide sequence of a chloramphenicol-resistance (CmR) determinant from the Gram- soil bacterium Agrobacterium tumefaciens was determined, and its gene product was identified as Cm acetyltransferase (CAT). Comparison of the amino acid sequences of the A. tumefaciens CAT and various CAT proteins of Gram+ and Gram- origin shows no homology between this and the other enzymes. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.