Molecule Information
      General Information of the Molecule (ID: Mol00862)
  
  | Name | Chloramphenicol acetyltransferase (CAT)
                                ,Escherichia coli
                               | ||||
|---|---|---|---|---|---|
| Molecule Type | Protein | ||||
| Gene Name | catIII | ||||
| Sequence | MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQ AVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVME RYKSDTKLFPQGVTPENHLNISALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLL LPLSVQVHHAVCDGFHVARFISRLQELCNSKLK     Click to Show/Hide | ||||
| Function | This enzyme is an effector of chloramphenicol resistance in bacteria.     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Escherichia coli infection | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Acquired | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain k12 | 83333 | ||
| Escherichia coli strain JM111 | 83333 | |||
| Experiment for Molecule Alteration | DNA sequencing assay | |||
| Mechanism Description | Enzymic acetylation catalysed by chloramphenicol acetyltransferase is the commonest mechanism of bacterial resistance to the antibiotic chloramphenicol, an inhibitor of prokaryotic peptidyl-transferase activity. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
