Molecule Information
General Information of the Molecule (ID: Mol00861)
Name |
Chloramphenicol 3-O phosphotransferase (CH3OP)
,Streptomyces venezuelae
|
||||
---|---|---|---|---|---|
Synonyms |
CPT; SVEN_4064
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
SVEN_4064
|
||||
Sequence |
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADG
GVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVR CDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP Click to Show/Hide
|
||||
Function |
Inactivates chloramphenicol by catalyzing the transfer of the gamma-phosphate of ATP to the antibiotic's C-3' hydroxyl group.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Streptomyces venezuelae infection | [1] | |||
Resistant Disease | Streptomyces venezuelae infection [ICD-11: 1C43.10] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli JM101 | 562 | ||
Streptomyces lividans strain M252 | 1916 | |||
Experiment for Molecule Alteration |
Dideoxy chain-termination method assay | |||
Experiment for Drug Resistance |
Measuring the diameters of inhibition zones around the disks assay | |||
Mechanism Description | The product of the ORF from S. venezuelae as an enzymic effector of Cm resistance in the producing organism by 3'-O-phosphorylation. We suggest the trivial name chloramphenicol 3'-O-phosphotransferase for the enzyme. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.