Molecule Information

General Information of the Molecule (ID: Mol00861)

• Name: Chloramphenicol 3-O phosphotransferase (CH3OP) ,Streptomyces venezuelae
• Synonyms: CPT; SVEN_4064
• Molecule Type: Protein
• Gene Name: SVEN_4064
• Sequence:
  MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADG
  GVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVR
  CDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
• Function: Inactivates chloramphenicol by catalyzing the transfer of the gamma-phosphate of ATP to the antibiotic's C-3' hydroxyl group.
• Uniprot ID: CPT_STRVP

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces venezuelae

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Streptomyces venezuelae infection [1]

• Resistant Disease: Streptomyces venezuelae infection [ICD-11: 1C43.10]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli JM101; 562
• In Vitro Model: Streptomyces lividans strain M252; 1916
• Experiment for Molecule Alteration: Dideoxy chain-termination method assay
• Experiment for Drug Resistance: Measuring the diameters of inhibition zones around the disks assay
• Mechanism Description: The product of the ORF from S. venezuelae as an enzymic effector of Cm resistance in the producing organism by 3'-O-phosphorylation. We suggest the trivial name chloramphenicol 3'-O-phosphotransferase for the enzyme.

References

• Ref 1: Inactivation of chloramphenicol by O-phosphorylation. A novel resistance mechanism in Streptomyces venezuelae ISP5230, a chloramphenicol producer. J Biol Chem. 1995 Nov 10;270(45):27000-6. doi: 10.1074/jbc.270.45.27000.