Molecule Information
General Information of the Molecule (ID: Mol00861)
| Name |
Chloramphenicol 3-O phosphotransferase (CH3OP)
,Streptomyces venezuelae
|
||||
|---|---|---|---|---|---|
| Synonyms |
CPT; SVEN_4064
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
SVEN_4064
|
||||
| Sequence |
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADG
GVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVR CDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Inactivates chloramphenicol by catalyzing the transfer of the gamma-phosphate of ATP to the antibiotic's C-3' hydroxyl group.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Streptomyces venezuelae infection [ICD-11: 1C43.10] | [1] | |||
| Resistant Disease | Streptomyces venezuelae infection [ICD-11: 1C43.10] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli JM101 | 562 | ||
| Streptomyces lividans strain M252 | 1916 | |||
| Experiment for Molecule Alteration |
Dideoxy chain-termination method assay | |||
| Experiment for Drug Resistance |
Measuring the diameters of inhibition zones around the disks assay | |||
| Mechanism Description | The product of the ORF from S. venezuelae as an enzymic effector of Cm resistance in the producing organism by 3'-O-phosphorylation. We suggest the trivial name chloramphenicol 3'-O-phosphotransferase for the enzyme. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
