Molecule Information

General Information of the Molecule (ID: Mol00858)

• Name: CATB6 chloramphenicol acetyltransferase (CATB6) ,Pseudomonas aeruginosa
• Synonyms: catB6; CatB6 protein
• Molecule Type: Protein
• Gene Name: catB6
• Sequence:
  MENYFDSPFKGKLLSEQVTNRNIKVGRYSYYSGYYHGHSFDDCARYLLPDRDDVDKLIIG
  SFCSIGSGASFIMAGNQGHRHDWVTSFPFFYMQEEPAFSSSTDAFQKAGDTIVGNDVWIG
  SEAMIMPGIKIGDGAVIGSRSLVTRDVEPYTIIGGNPAKQIKKRFSDEEISLLMEMEWWN
  WPLDKIKTAMPLLCSSDIFGLHRHWRGIAV
• Uniprot ID: Q9R818_PSEAI

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] [1]

• Resistant Disease: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli; 668369
• In Vitro Model: Pseudomonas aeruginosa strain 101/1477; 287
• Experiment for Molecule Alteration: Southern blotting assay
• Experiment for Drug Resistance: Broth microdilution assay
• Mechanism Description: The third gene cassette is 730 bp long and contains an open reading frame (ORF) potentially encoding a protein that exhibits a high degree of sequence similarity to members of the CATB lineage of chloramphenicol acetyltransferases. The new catB allele appeared to be functional since both DH5alpha(pPAM-101) and DH5alpha(pkAM-36BE) showed a decreased chloramphenicol susceptibility and was named catB6.

Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Acquired
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli; 668369
• In Vitro Model: Pseudomonas aeruginosa strain 101/1477; 287
• Experiment for Molecule Alteration: Southern blotting assay
• Experiment for Drug Resistance: Broth microdilution assay
• Mechanism Description: The third gene cassette is 730 bp long and contains an open reading frame (ORF) potentially encoding a protein that exhibits a high degree of sequence similarity to members of the CATB lineage of chloramphenicol acetyltransferases. The new catB allele appeared to be functional since both DH5alpha(pPAM-101) and DH5alpha(pkAM-36BE) showed a decreased chloramphenicol susceptibility and was named catB6.

References

• Ref 1: Structure of In31, a blaIMP-containing Pseudomonas aeruginosa integron phyletically related to In5, which carries an unusual array of gene cassettes. Antimicrob Agents Chemother. 1999 Apr;43(4):890-901. doi: 10.1128/AAC.43.4.890.