Molecule Information
      General Information of the Molecule (ID: Mol00852)
  
  | Name | Capreomycin acetyltransferase (CPAA)
                                ,Paenibacillus sp.
                               | ||||
|---|---|---|---|---|---|
| Synonyms | cpaA; AK95_27390; CpaA     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | cpaA | ||||
| Sequence | MPLRITAMTETYADQIMQWSYEPPYDFYNSEPDEEFRKELLECSYYAILDKEGQLFGFCC TGSSAQIPIAIPLGAYDEDLLDFGLGMKPESTGQCRGKEFLSFVLASIAEFHKRQSFRLT VAKFNERAIRLYTQLGFSEVATFDYGGTTFITMIKKPGSGL     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Capreomycin | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Paenibacillus sp. LC231 | 1120679 | ||
| Experiment for Molecule Alteration | Whole genome sequence assay | |||
| Experiment for Drug Resistance | Broth microdilution method assay | |||
| Mechanism Description | CpaA inactivates capreomycin by acetylating the alpha-amino group of diaminopropionic acid at position 1. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
