Molecule Information
General Information of the Molecule (ID: Mol00851)
| Name |
CAM-1 carbapenemase (CAM1)
,Pseudomonas aeruginosa
|
||||
|---|---|---|---|---|---|
| Synonyms |
ICEPACAM-1_00375
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
blaCAM-1
|
||||
| Sequence |
MKSTAIILFLLVFSLGVFGQTGDALKISQLSGDFYIFTTYQTYKDAKVSANGMYVVTDEG
VVLIDTPWDETQLQPLLNYIKEKHNKDVVMSVSTHFHEDRTNGIEFLRTKGVKTYTTKKT DELSQKKGYERAEFLLEKDTEFKIGQYKFQTYYPGEGHAPDNIVVWFPNERILYGGCFIK STEAEDIGNLSDANIDEWSNSIKNVQKKFKNPKFVIPGHDGWASTKSLKHTLKLIKKTRK K Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas infection | [1] | |||
| Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
| Resistant Drug | Cefotaxime | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Pseudomonas aeruginosa N17-01167 | 287 | |||
| Pseudomonas aeruginosa N17-01173 | 287 | |||
| Pseudomonas aeruginosa N17-02436 | 287 | |||
| Pseudomonas aeruginosa N17-02437 | 287 | |||
| Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
| Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
| Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas infection | [1] | |||
| Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
| Resistant Drug | Cefoxitin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Pseudomonas aeruginosa N17-01167 | 287 | |||
| Pseudomonas aeruginosa N17-01173 | 287 | |||
| Pseudomonas aeruginosa N17-02436 | 287 | |||
| Pseudomonas aeruginosa N17-02437 | 287 | |||
| Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
| Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
| Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas infection | [1] | |||
| Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
| Resistant Drug | Ceftazidime | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Pseudomonas aeruginosa N17-01167 | 287 | |||
| Pseudomonas aeruginosa N17-01173 | 287 | |||
| Pseudomonas aeruginosa N17-02436 | 287 | |||
| Pseudomonas aeruginosa N17-02437 | 287 | |||
| Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
| Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
| Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas infection | [1] | |||
| Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
| Resistant Drug | Doripenem | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Pseudomonas aeruginosa N17-01167 | 287 | |||
| Pseudomonas aeruginosa N17-01173 | 287 | |||
| Pseudomonas aeruginosa N17-02436 | 287 | |||
| Pseudomonas aeruginosa N17-02437 | 287 | |||
| Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
| Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
| Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas infection | [1] | |||
| Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
| Resistant Drug | Meropenem | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Pseudomonas aeruginosa N17-01167 | 287 | |||
| Pseudomonas aeruginosa N17-01173 | 287 | |||
| Pseudomonas aeruginosa N17-02436 | 287 | |||
| Pseudomonas aeruginosa N17-02437 | 287 | |||
| Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
| Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
| Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas infection | [1] | |||
| Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
| Resistant Drug | Imipenem | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Pseudomonas aeruginosa N17-01167 | 287 | |||
| Pseudomonas aeruginosa N17-01173 | 287 | |||
| Pseudomonas aeruginosa N17-02436 | 287 | |||
| Pseudomonas aeruginosa N17-02437 | 287 | |||
| Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
| Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
| Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. | |||
Clinical Trial Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas infection | [1] | |||
| Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
| Resistant Drug | Ceftolozane sulfate | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Pseudomonas aeruginosa N17-01167 | 287 | |||
| Pseudomonas aeruginosa N17-01173 | 287 | |||
| Pseudomonas aeruginosa N17-02436 | 287 | |||
| Pseudomonas aeruginosa N17-02437 | 287 | |||
| Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
| Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
| Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. | |||
Investigative Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas infection | [1] | |||
| Resistant Disease | Pseudomonas infection [ICD-11: 1F45.1] | |||
| Resistant Drug | Piperacillin/Tazobactam | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Pseudomonas aeruginosa N17-01167 | 287 | |||
| Pseudomonas aeruginosa N17-01173 | 287 | |||
| Pseudomonas aeruginosa N17-02436 | 287 | |||
| Pseudomonas aeruginosa N17-02437 | 287 | |||
| Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
| Experiment for Drug Resistance |
Vitek 2 assay; Etest assay | |||
| Mechanism Description | A novel class B Beta-lactamase gene, blaCAM-1, exhibited resistance to imipenem, meropenem, doripenem, cefotaxime, ceftazidime, cefoxitin, piperacillin/tazobactam, ceftazidime/avibactam and ceftolozane/tazobactam. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
