Molecule Information
General Information of the Molecule (ID: Mol00849)
| Name |
Bifunctional AAC/APH (AAC/APH)
,Campylobacter jejuni
|
||||
|---|---|---|---|---|---|
| Synonyms |
aph(2'')
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
aac(6')
|
||||
| Sequence |
MEIVQDKIRIRTLTNDDFPLMLKWLTDDRVLEFYGGRDKKYTLESLKEHYTEKWEDEVFR
VIIEYDNVPIGYGQVYKMYDELYSDYHYPKTNEIVYGMDQFIGEPEYWSKGIGSKYTKMI FEFLKKERNANAVILDPHKNNPRAIRSYQKSGFRIIEDLPEHELHEGKKEDCYLMEYRYD DNVTNVKAMKYLIEHYFEDFKVESIKVIGSGYDSVAYLVNGEYIFKTKFSANKKKGYEKE KAIYDFLNQRLNTNIKIPNVKYSYFSDNISILGYKEIKGTFLTPEIYFALSKEKQELLKQ DIAMFLRQMHDLDYSEISLYTIDNKQNVLEEYQLLKDTIYDSLTDIEKQYVEDFMQRLHS TTIFDGKKCLCHNDFSCNHLLLDDENRLCGVIDFGDSGIIDEYCDFIYLLEDSEEEIGVS FGEDILRLYGNIDISKAKEYQDVVEQYYPIETIVYGIKNNRPDFIEKGRKEIYIRTRKDE KLRK Click to Show/Hide
|
||||
| Function |
Involved in resistance to gentamicin, tobramycin, and kanamycin. Tobramycin and kanamycin resistance is due to the ACC activity, specified by N-terminal region. The C-terminal region is a kinase that phosphorylates several 4,6-disubstituted aminoglycosides.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Dibekacin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Dibekacin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Respiratory trac infection [ICD-11: CA45.0] | [1] | |||
| Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
| Resistant Drug | Dibekacin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Infective endocarditis [ICD-11: BB40.0] | [1] | |||
| Resistant Disease | Infective endocarditis [ICD-11: BB40.0] | |||
| Resistant Drug | Dibekacin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Sepsis [ICD-11: 1G40.0] | [1] | |||
| Resistant Disease | Sepsis [ICD-11: 1G40.0] | |||
| Resistant Drug | Dibekacin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Dibekacin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Gentamicin A | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Gentamicin A | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Respiratory trac infection [ICD-11: CA45.0] | [1] | |||
| Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
| Resistant Drug | Gentamicin A | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Infective endocarditis [ICD-11: BB40.0] | [1] | |||
| Resistant Disease | Infective endocarditis [ICD-11: BB40.0] | |||
| Resistant Drug | Gentamicin A | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Sepsis [ICD-11: 1G40.0] | [1] | |||
| Resistant Disease | Sepsis [ICD-11: 1G40.0] | |||
| Resistant Drug | Gentamicin A | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Gentamicin A | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Respiratory trac infection [ICD-11: CA45.0] | [1] | |||
| Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Infective endocarditis [ICD-11: BB40.0] | [1] | |||
| Resistant Disease | Infective endocarditis [ICD-11: BB40.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Sepsis [ICD-11: 1G40.0] | [1] | |||
| Resistant Disease | Sepsis [ICD-11: 1G40.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Sisomicin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Sisomicin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Respiratory trac infection [ICD-11: CA45.0] | [1] | |||
| Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
| Resistant Drug | Sisomicin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Infective endocarditis [ICD-11: BB40.0] | [1] | |||
| Resistant Disease | Infective endocarditis [ICD-11: BB40.0] | |||
| Resistant Drug | Sisomicin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Sepsis [ICD-11: 1G40.0] | [1] | |||
| Resistant Disease | Sepsis [ICD-11: 1G40.0] | |||
| Resistant Drug | Sisomicin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Sisomicin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Tobramycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Tobramycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Respiratory trac infection [ICD-11: CA45.0] | [1] | |||
| Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
| Resistant Drug | Tobramycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Infective endocarditis [ICD-11: BB40.0] | [1] | |||
| Resistant Disease | Infective endocarditis [ICD-11: BB40.0] | |||
| Resistant Drug | Tobramycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Sepsis [ICD-11: 1G40.0] | [1] | |||
| Resistant Disease | Sepsis [ICD-11: 1G40.0] | |||
| Resistant Drug | Tobramycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
| Disease Class: Gram-negative pathogens infection [ICD-11: 1B74-1G40] | [1] | |||
| Resistant Disease | Gram-negative pathogens infection [ICD-11: 1B74-1G40] | |||
| Resistant Drug | Tobramycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
| Escherichia coli JM83 | 562 | |||
| Experiment for Molecule Alteration |
SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside 2"-phosphotransferases are the major aminoglycoside-modifying enzymes in clinical isolates of enterococci and staphylococci.APH(2")-If. This enzyme confers resistance to the 4,6-disubstituted aminoglycosides kanamycin, tobramycin, dibekacin, gentamicin, and sisomicin, but not to arbekacin, amikacin, isepamicin, or netilmicin. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
