General Information of the Molecule (ID: Mol00842)
Name
Beta-lactamase (BLA) ,Bacteroides vulgatus
Molecule Type
Protein
Gene Name
cfxA
Sequence
MEKNRKKQIVVLSIALVCIFILVFSLFHKSATKDSANPPLTNVLTDSISQIVSACPGEIG
VAVIVNNRDTVKVNNKSVYPMMSVFKVHQALALCNDFDNKGISLDTLVNINRDKLDPKTW
SPMLKDYSGPVISLTVRDLLRYTLTQSDNNASNLMFKDMVNVAQTDSFIATLIPRSSFQI
AYTEEEMSADHNKAYSNYTSPLGAAMLMNRLFTEGLIDDEKQSFIKNTLKECKTGVDRIA
APLLDKEGVVIAHKTGSGYVNENGVLAAHNDVAYICLPNNISYTLAVFVKDFKGNKSQAS
QYVAHISAVVYSLLMQTSVKS
    Click to Show/Hide
Function
Can hydrolyze cephalosporins, penicillins and also cefoxitin; but at a slow rate.
    Click to Show/Hide
Uniprot ID
BLAC_PHOVU
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Bacteroidetes
Class: Bacteroidia
Order: Bacteroidales
Family: Bacteroidaceae
Genus: Phocaeicola
Species: Phocaeicola vulgatus
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cefoxitin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacteroides infection [ICD-11: 1C4Y.7] [1]
Resistant Disease Bacteroides infection [ICD-11: 1C4Y.7]
Resistant Drug Cefoxitin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain HB101 634468
Escherichia coli strain DH5a 668369
Bacteroides uniformis strain V528 820
Bacteroides fragilis strain 638 862962
Bacteroides fragilis strain IB246 817
Bacteroides fragilis strain IB246flpSUC2C 817
Bacteroides fragilis strain IB247 817
Bacteroides vulgatus strain CLA341 821
Experiment for
Molecule Alteration
Nucleotide sequence assay
Experiment for
Drug Resistance
Standard broth microdilution method assay
Mechanism Description The beta-lactamase gene (cfxA) was subcloned on a 2.2-kb DraI-HindIII fragment, and the nucleotide sequence was determined. These results showed that cfxA encoded a protein of 321 amino acids and 35,375 molecular weight. Mutant strains in which the cfxA structural gene was disrupted by insertional inactivation lost both Fxr and beta-lactamase activity.
References
Ref 1 Genetic and biochemical analysis of a novel Ambler class A beta-lactamase responsible for cefoxitin resistance in Bacteroides species. Antimicrob Agents Chemother. 1993 May;37(5):1028-36. doi: 10.1128/AAC.37.5.1028.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.