Molecule Information
General Information of the Molecule (ID: Mol00842)
Name |
Beta-lactamase (BLA)
,Bacteroides vulgatus
|
||||
---|---|---|---|---|---|
Molecule Type |
Protein
|
||||
Gene Name |
cfxA
|
||||
Sequence |
MEKNRKKQIVVLSIALVCIFILVFSLFHKSATKDSANPPLTNVLTDSISQIVSACPGEIG
VAVIVNNRDTVKVNNKSVYPMMSVFKVHQALALCNDFDNKGISLDTLVNINRDKLDPKTW SPMLKDYSGPVISLTVRDLLRYTLTQSDNNASNLMFKDMVNVAQTDSFIATLIPRSSFQI AYTEEEMSADHNKAYSNYTSPLGAAMLMNRLFTEGLIDDEKQSFIKNTLKECKTGVDRIA APLLDKEGVVIAHKTGSGYVNENGVLAAHNDVAYICLPNNISYTLAVFVKDFKGNKSQAS QYVAHISAVVYSLLMQTSVKS Click to Show/Hide
|
||||
Function |
Can hydrolyze cephalosporins, penicillins and also cefoxitin; but at a slow rate.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacteroides infection | [1] | |||
Resistant Disease | Bacteroides infection [ICD-11: 1C4Y.7] | |||
Resistant Drug | Cefoxitin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli strain HB101 | 634468 | ||
Escherichia coli strain DH5a | 668369 | |||
Bacteroides uniformis strain V528 | 820 | |||
Bacteroides fragilis strain 638 | 862962 | |||
Bacteroides fragilis strain IB246 | 817 | |||
Bacteroides fragilis strain IB246flpSUC2C | 817 | |||
Bacteroides fragilis strain IB247 | 817 | |||
Bacteroides vulgatus strain CLA341 | 821 | |||
Experiment for Molecule Alteration |
Nucleotide sequence assay | |||
Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
Mechanism Description | The beta-lactamase gene (cfxA) was subcloned on a 2.2-kb DraI-HindIII fragment, and the nucleotide sequence was determined. These results showed that cfxA encoded a protein of 321 amino acids and 35,375 molecular weight. Mutant strains in which the cfxA structural gene was disrupted by insertional inactivation lost both Fxr and beta-lactamase activity. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.