Molecule Information
      General Information of the Molecule (ID: Mol00837)
  
  | Name | Beta-lactamase (BLA)
                                ,Escherichia coli
                               | ||||
|---|---|---|---|---|---|
| Synonyms | blaCMY-42; G5603_25265; pCMY42_EC8_00033     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | CMY-42 | ||||
| Sequence | MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYY FTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQ WQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHSSPGQLDAEA YGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKA DSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLA NKSYPNPVRVEAAWRILEKLQ     Click to Show/Hide | ||||
| Function | This protein is a serine beta-lactamase with a substrate specificity for cephalosporins.     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      3 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Cefotaxime | |||
| Molecule Alteration | Mutantion | p.V231S | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli VA1171/10 | 562 | |||
| Experiment for Molecule Alteration | Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance | Quadruple disc test assay | |||
| Mechanism Description | Molecular methods revealed a novel, plasmid-localized variant of CMY-2 with a substitution of valine 231 for serine (V231S), which was designated CMY-42. Like the CMY-2-like AmpC beta-lactamase CMY-30, carrying the substitution V231G, CMY-42 displayed increased activity toward expanded spectrum cephalosporins. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Cefoxitin | |||
| Molecule Alteration | Mutantion | p.V231S | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli VA1171/10 | 562 | |||
| Experiment for Molecule Alteration | Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance | Quadruple disc test assay | |||
| Mechanism Description | Molecular methods revealed a novel, plasmid-localized variant of CMY-2 with a substitution of valine 231 for serine (V231S), which was designated CMY-42. Like the CMY-2-like AmpC beta-lactamase CMY-30, carrying the substitution V231G, CMY-42 displayed increased activity toward expanded spectrum cephalosporins. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Ceftazidime | |||
| Molecule Alteration | Missense mutation | p.V231S | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli VA1171/10 | 562 | |||
| Experiment for Molecule Alteration | Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance | Quadruple disc test assay | |||
| Mechanism Description | Molecular methods revealed a novel, plasmid-localized variant of CMY-2 with a substitution of valine 231 for serine (V231S), which was designated CMY-42. Like the CMY-2-like AmpC beta-lactamase CMY-30, carrying the substitution V231G, CMY-42 displayed increased activity toward expanded spectrum cephalosporins. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
