General Information of the Molecule (ID: Mol00836)
Name
Beta-lactamase (BLA) ,Escherichia coli
Molecule Type
Protein
Gene Name
blaCMY-61
Sequence
MMNRYAAALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYF
TWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQW
QGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGAL
AVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAY
GVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKAD
SIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLAN
KSYPNPVRVEAAWRILEKLQ
    Click to Show/Hide
Function
This protein is a serine beta-lactamase with a substrate specificity for cephalosporins.
    Click to Show/Hide
Uniprot ID
G3F7G9_ECOLX
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cefotaxime
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Cefotaxime
Molecule Alteration Missense mutation
p.Y221H
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Escherichia coli EC13 562
Experiment for
Molecule Alteration
Whole genome sequencing assay
Experiment for
Drug Resistance
Disk diffusion test assay
Mechanism Description The CMY-136 Beta-lactamase, a Y221H point mutant derivative of CMY-2,confers an increased level of resistance to ticarcillin, cefuroxime, cefotaxime, and ceftolozane/tazobactam.
Cefuroxime
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Cefuroxime
Molecule Alteration Missense mutation
p.Y221H
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Escherichia coli EC13 562
Experiment for
Molecule Alteration
Whole genome sequencing assay
Experiment for
Drug Resistance
Disk diffusion test assay
Mechanism Description The CMY-136 Beta-lactamase, a Y221H point mutant derivative of CMY-2,confers an increased level of resistance to ticarcillin, cefuroxime, cefotaxime, and ceftolozane/tazobactam.
Clinical Trial Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ceftolozane sulfate
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Ceftolozane sulfate
Molecule Alteration Missense mutation
p.Y221H
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Escherichia coli EC13 562
Experiment for
Molecule Alteration
Whole genome sequencing assay
Experiment for
Drug Resistance
Disk diffusion test assay
Mechanism Description The CMY-136 Beta-lactamase, a Y221H point mutant derivative of CMY-2,confers an increased level of resistance to ticarcillin, cefuroxime, cefotaxime, and ceftolozane/tazobactam.
References
Ref 1 Genetic, Biochemical, and Structural Characterization of CMY-136 Beta-Lactamase, a Peculiar CMY-2 Variant. ACS Infect Dis. 2019 Apr 12;5(4):528-538. doi: 10.1021/acsinfecdis.8b00240. Epub 2019 Mar 7.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.