General Information of the Molecule (ID: Mol00835)
Name
Beta-lactamase (BLA) ,Escherichia coli
Synonyms
blaNDM-5; blaNDM; C5N07_29035; CWS33_26475; D0X26_01580; D0X26_30180; EI021_24930; EIZ93_26035; EYV17_23675; EYV18_23855; G5632_22505; pEC1929_0014; TUM18780_51250; Beta-lactamase II; Class B carbapenemase NDM-5; Class B metallo-beta-lactamase NDM-5; Metallo-beta-lactamase NDM-5; NDM-5; NDM-5 metallo-beta-lactamase; New Delhi Metallo carbapenemase protein; New Delhi metallo beta lactamase 5; Subclass B1 metallo-beta-lactamase NDM-5
    Click to Show/Hide
Molecule Type
Protein
Gene Name
blaNDM-5
Gene ID
39459987
Sequence
MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQ
HTSYLDMPGFGAVASNGLIVRDGGRVLLVDTAWTDDQTAQILNWIKQEINLPVALAVVTH
AHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPL
KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF
PKASMIVMSHSAPDSRAAITHTARMADKLR
    Click to Show/Hide
Uniprot ID
G3K399_ECOLX
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cefoxitin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Cefoxitin
Molecule Alteration Missense mutation
p.V88L+p.M154L
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Escherichia coli ST648 562
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Etest assay
Mechanism Description NDM-5 differed from existing enzymes due to substitutions at positions 88 (Val - Leu) and 154 (Met - Leu) and reduced the susceptibility of Escherichia coli TOP10 transformants to expanded-spectrum cephalosporins and carbapenems when expressed under its native promoter.
Ceftazidime
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Ceftazidime
Molecule Alteration Missense mutation
p.V88L+p.M154L
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Escherichia coli ST648 562
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Etest assay
Mechanism Description NDM-5 differed from existing enzymes due to substitutions at positions 88 (Val - Leu) and 154 (Met - Leu) and reduced the susceptibility of Escherichia coli TOP10 transformants to expanded-spectrum cephalosporins and carbapenems when expressed under its native promoter.
Ertapenem
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Ertapenem
Molecule Alteration Missense mutation
p.V88L+p.M154L
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Escherichia coli ST648 562
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Etest assay
Mechanism Description NDM-5 differed from existing enzymes due to substitutions at positions 88 (Val - Leu) and 154 (Met - Leu) and reduced the susceptibility of Escherichia coli TOP10 transformants to expanded-spectrum cephalosporins and carbapenems when expressed under its native promoter.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Piperacillin/Tazobactam
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Piperacillin/Tazobactam
Molecule Alteration Missense mutation
p.V88L+p.M154L
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Escherichia coli ST648 562
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Etest assay
Mechanism Description NDM-5 differed from existing enzymes due to substitutions at positions 88 (Val - Leu) and 154 (Met - Leu) and reduced the susceptibility of Escherichia coli TOP10 transformants to expanded-spectrum cephalosporins and carbapenems when expressed under its native promoter.
References
Ref 1 A novel variant, NDM-5, of the New Delhi metallo-Beta-lactamase in a multidrug-resistant Escherichia coli ST648 isolate recovered from a patient in the United Kingdom. Antimicrob Agents Chemother. 2011 Dec;55(12):5952-4. doi: 10.1128/AAC.05108-11. Epub 2011 Sep 19.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.