Molecule Information
General Information of the Molecule (ID: Mol00832)
| Name |
Beta-lactamase (BLA)
,Citrobacter freundii
|
||||
|---|---|---|---|---|---|
| Synonyms |
bla CTX-M-3; blaCTX-M-3; blaCTX-M3; AN672_26965
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
bla
|
||||
| Sequence |
MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ
ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGS GDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTDGL Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Ampicillin | |||
| Molecule Alteration | Missense mutation | p.V77A+p.D114N+p.S140A+p.N288D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Citrobacter freundii strain 2524/96 | 546 | ||
| Citrobacter freundii strain 2525/96 | 546 | |||
| Citrobacter freundii strain 2526/96 | 546 | |||
| Escherichia coli strain 2527/96 | 562 | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Sequencing has revealed that C. freundii isolates produced a new CTX-M-3 enzyme which is very closely related to the CTX-M-1/MEN-1 Beta-lactamase. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Aztreonam | |||
| Molecule Alteration | Missense mutation | p.V77A+p.D114N+p.S140A+p.N288D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Citrobacter freundii strain 2524/96 | 546 | ||
| Citrobacter freundii strain 2525/96 | 546 | |||
| Citrobacter freundii strain 2526/96 | 546 | |||
| Escherichia coli strain 2527/96 | 562 | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Sequencing has revealed that C. freundii isolates produced a new CTX-M-3 enzyme which is very closely related to the CTX-M-1/MEN-1 Beta-lactamase. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Cefotaxime | |||
| Molecule Alteration | Missense mutation | p.V77A+p.D114N+p.S140A+p.N288D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Citrobacter freundii strain 2524/96 | 546 | ||
| Citrobacter freundii strain 2525/96 | 546 | |||
| Citrobacter freundii strain 2526/96 | 546 | |||
| Escherichia coli strain 2527/96 | 562 | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Sequencing has revealed that C. freundii isolates produced a new CTX-M-3 enzyme which is very closely related to the CTX-M-1/MEN-1 Beta-lactamase. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Cefoxitin | |||
| Molecule Alteration | Missense mutation | p.V77A+p.D114N+p.S140A+p.N288D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Citrobacter freundii strain 2524/96 | 546 | ||
| Citrobacter freundii strain 2525/96 | 546 | |||
| Citrobacter freundii strain 2526/96 | 546 | |||
| Escherichia coli strain 2527/96 | 562 | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Sequencing has revealed that C. freundii isolates produced a new CTX-M-3 enzyme which is very closely related to the CTX-M-1/MEN-1 Beta-lactamase. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Piperacillin | |||
| Molecule Alteration | Missense mutation | p.V77A+p.D114N+p.S140A+p.N288D |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Citrobacter freundii strain 2524/96 | 546 | ||
| Citrobacter freundii strain 2525/96 | 546 | |||
| Citrobacter freundii strain 2526/96 | 546 | |||
| Escherichia coli strain 2527/96 | 562 | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Sequencing has revealed that C. freundii isolates produced a new CTX-M-3 enzyme which is very closely related to the CTX-M-1/MEN-1 Beta-lactamase. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
