Molecule Information
General Information of the Molecule (ID: Mol00829)
Name |
Beta-lactamase (BLA)
,Rhodobacter sphaeroides
|
||||
---|---|---|---|---|---|
Synonyms |
RSP_3749
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
ampC
|
||||
Sequence |
MKHLSPLSILLMVGALTPALAQDTTPSFESAAAAAFESVIEEHDIPGLVVGVTHGGRHSF
YQTGLASREDQQPVTPDTLFELGSISKIFNVTLAALAEERGALSLDAPVADYLPSLRGSP AGELTLIDLATHHTGGLPLQVPDEVADVDRLVDWLRSWRPPEPGTRSYSNISIGLLGHIT AGVLGMSYADASQTVIFPALGLKSTWIDVPTDAMGRYAFGYDRKTDAPTRVTPGVLDDEA YGVKSSARDMLTLLDLELGTGTASPEVQTAVATTQEGRFQTRLYTQAMIWEAYPWPVDPE RLVEGNGYDFILQPQPVDEVDTTPDRRVILNKTGSTNGFGGYIAIVPSEDLGVVVLANRN YPNEARVRATYDLITHILAE Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Rhodobacter sphaeroides infection | [1] | |||
Resistant Disease | Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Benzylpenicillin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Rhodopseudomonas sphaeroides strain DSM 160(Y) | 1063 | ||
Rhodopseudomonas sphaeroides strain DSM158 | 1063 | |||
Rhodopseudomonas sphaeroides strain DSM159 | 1063 | |||
Experiment for Molecule Alteration |
Sodium dodecyl sulfate-PAGE assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Rhodobacter sphaeroides infection | [1] | |||
Resistant Disease | Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Cefalotin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Rhodopseudomonas sphaeroides strain DSM 160(Y) | 1063 | ||
Rhodopseudomonas sphaeroides strain DSM158 | 1063 | |||
Rhodopseudomonas sphaeroides strain DSM159 | 1063 | |||
Experiment for Molecule Alteration |
Sodium dodecyl sulfate-PAGE assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Rhodobacter sphaeroides infection | [1] | |||
Resistant Disease | Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Cefradine | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Rhodopseudomonas sphaeroides strain DSM 160(Y) | 1063 | ||
Rhodopseudomonas sphaeroides strain DSM158 | 1063 | |||
Rhodopseudomonas sphaeroides strain DSM159 | 1063 | |||
Experiment for Molecule Alteration |
Sodium dodecyl sulfate-PAGE assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Rhodobacter sphaeroides infection | [1] | |||
Resistant Disease | Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Cephalexin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Rhodopseudomonas sphaeroides strain DSM 160(Y) | 1063 | ||
Rhodopseudomonas sphaeroides strain DSM158 | 1063 | |||
Rhodopseudomonas sphaeroides strain DSM159 | 1063 | |||
Experiment for Molecule Alteration |
Sodium dodecyl sulfate-PAGE assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Rhodobacter sphaeroides infection | [1] | |||
Resistant Disease | Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Cephalosporin C | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Rhodopseudomonas sphaeroides strain DSM 160(Y) | 1063 | ||
Rhodopseudomonas sphaeroides strain DSM158 | 1063 | |||
Rhodopseudomonas sphaeroides strain DSM159 | 1063 | |||
Experiment for Molecule Alteration |
Sodium dodecyl sulfate-PAGE assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Rhodobacter sphaeroides infection | [1] | |||
Resistant Disease | Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Cephapirin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Rhodopseudomonas sphaeroides strain DSM 160(Y) | 1063 | ||
Rhodopseudomonas sphaeroides strain DSM158 | 1063 | |||
Rhodopseudomonas sphaeroides strain DSM159 | 1063 | |||
Experiment for Molecule Alteration |
Sodium dodecyl sulfate-PAGE assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Rhodobacter sphaeroides infection | [1] | |||
Resistant Disease | Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Meticillin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Rhodopseudomonas sphaeroides strain DSM 160(Y) | 1063 | ||
Rhodopseudomonas sphaeroides strain DSM158 | 1063 | |||
Rhodopseudomonas sphaeroides strain DSM159 | 1063 | |||
Experiment for Molecule Alteration |
Sodium dodecyl sulfate-PAGE assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.