General Information of the Molecule (ID: Mol00829)
Name
Beta-lactamase (BLA) ,Rhodobacter sphaeroides
Synonyms
RSP_3749
    Click to Show/Hide
Molecule Type
Protein
Gene Name
ampC
Sequence
MKHLSPLSILLMVGALTPALAQDTTPSFESAAAAAFESVIEEHDIPGLVVGVTHGGRHSF
YQTGLASREDQQPVTPDTLFELGSISKIFNVTLAALAEERGALSLDAPVADYLPSLRGSP
AGELTLIDLATHHTGGLPLQVPDEVADVDRLVDWLRSWRPPEPGTRSYSNISIGLLGHIT
AGVLGMSYADASQTVIFPALGLKSTWIDVPTDAMGRYAFGYDRKTDAPTRVTPGVLDDEA
YGVKSSARDMLTLLDLELGTGTASPEVQTAVATTQEGRFQTRLYTQAMIWEAYPWPVDPE
RLVEGNGYDFILQPQPVDEVDTTPDRRVILNKTGSTNGFGGYIAIVPSEDLGVVVLANRN
YPNEARVRATYDLITHILAE
    Click to Show/Hide
3D-structure
PDB ID
7MQN
Classification
Hydrolase
Method
X-ray diffraction
Resolution
2.21  Å
Uniprot ID
Q3IVS9_CERS4
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Alphaproteobacteria
Order: Rhodobacterales
Family: Rhodobacteraceae
Genus: Cereibacter
Species: Cereibacter sphaeroides
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
Click to Show/Hide the Full List of Drugs
Benzylpenicillin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
Resistant Drug Benzylpenicillin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Rhodopseudomonas sphaeroides strain DSM 160(Y) 1063
Rhodopseudomonas sphaeroides strain DSM158 1063
Rhodopseudomonas sphaeroides strain DSM159 1063
Experiment for
Molecule Alteration
Sodium dodecyl sulfate-PAGE assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.
Cefalotin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
Resistant Drug Cefalotin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Rhodopseudomonas sphaeroides strain DSM 160(Y) 1063
Rhodopseudomonas sphaeroides strain DSM158 1063
Rhodopseudomonas sphaeroides strain DSM159 1063
Experiment for
Molecule Alteration
Sodium dodecyl sulfate-PAGE assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.
Cefradine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
Resistant Drug Cefradine
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Rhodopseudomonas sphaeroides strain DSM 160(Y) 1063
Rhodopseudomonas sphaeroides strain DSM158 1063
Rhodopseudomonas sphaeroides strain DSM159 1063
Experiment for
Molecule Alteration
Sodium dodecyl sulfate-PAGE assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.
Cephalexin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
Resistant Drug Cephalexin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Rhodopseudomonas sphaeroides strain DSM 160(Y) 1063
Rhodopseudomonas sphaeroides strain DSM158 1063
Rhodopseudomonas sphaeroides strain DSM159 1063
Experiment for
Molecule Alteration
Sodium dodecyl sulfate-PAGE assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.
Cephalosporin C
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
Resistant Drug Cephalosporin C
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Rhodopseudomonas sphaeroides strain DSM 160(Y) 1063
Rhodopseudomonas sphaeroides strain DSM158 1063
Rhodopseudomonas sphaeroides strain DSM159 1063
Experiment for
Molecule Alteration
Sodium dodecyl sulfate-PAGE assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.
Cephapirin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
Resistant Drug Cephapirin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Rhodopseudomonas sphaeroides strain DSM 160(Y) 1063
Rhodopseudomonas sphaeroides strain DSM158 1063
Rhodopseudomonas sphaeroides strain DSM159 1063
Experiment for
Molecule Alteration
Sodium dodecyl sulfate-PAGE assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.
Meticillin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Rhodobacter sphaeroides infection [ICD-11: 1A00-1C4Z]
Resistant Drug Meticillin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Rhodopseudomonas sphaeroides strain DSM 160(Y) 1063
Rhodopseudomonas sphaeroides strain DSM158 1063
Rhodopseudomonas sphaeroides strain DSM159 1063
Experiment for
Molecule Alteration
Sodium dodecyl sulfate-PAGE assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description Thirteen strains of the gram-negative, facultative phototrophic bacterium Rhodobacter sphaeroides were examined fro susceptibility to beta-lactam antibiotics. All strains were sensitive to the semisynthetic penicillins ampicillin, carbenicillin, oxacillin, cloxacillin, and methicillin, but 10 of the 13 strains were resistant to penicillin G, as well as a number of cephalosporins, such as cephalothin, cephapirin, and cephalosporin C. A beta-lactamase (EC 3.5.2.6) with strong cephalosporinase activity was detected in all of the resistant strains of R. sphaeroides. With strain Y-1 as a model, it was shown that the beta-lactamase was inducible by penicillin G, cephalosporin C, cephalothin, and to some minor extent, cephapirin.
References
Ref 1 Susceptibility of Rhodobacter sphaeroides to beta-lactam antibiotics: isolation and characterization of a periplasmic beta-lactamase (cephalosporinase). J Bacteriol. 1989 Jan;171(1):308-13. doi: 10.1128/jb.171.1.308-313.1989.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.