Molecule Information

General Information of the Molecule (ID: Mol00827)

• Name: Beta-lactamase (BLA) ,Pseudomonas aeruginosa
• Synonyms: blaOxa-50c; blaOXA-50b; blaOXA-50g; IPC1494_23315; IPC152_19190; IPC1595_21065; IPC57_19425; IPC607_22635; EC 3.5.2.6; OXA-50 family oxacillin-hydrolyzing class D beta-lactamase OXA-488; Oxacillinase
• Molecule Type: Protein
• Gene Name: blaOxa-50c
• Sequence:
  MRPLLFSALLLLSGHAQASEWNDSRAVDKLFGAAGVKGTFVLYDVQRQRYVGHDRERAET
  RFVPASTYKVANSLIGLSTGAVRSADEVLPYGGKPQRFKAWEHDMSLRDAIKASNVPVYQ
  ELARRIGLERMRANVSRLGYGNAEIGQVVDNFWLVGPLKISAMEQTRFLLRLAQGELPFP
  APVQSTVRAMTLLESGPGWELHGKTGWCFDCTPELGWWVGWVKRNERLYGFALNIDMPGG
  EADIGKRVELGKASLKALGILP
• Uniprot ID: Q6JTT6_PSEAI

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Ampicillin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Pseudomonas aeruginosa infection [1]

• Resistant Disease: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Ampicillin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Pseudomonas aeruginosa PAO1; 208964
• Experiment for Molecule Alteration: DNA sequencing and protein assay
• Experiment for Drug Resistance: Disk diffusion assay
• Mechanism Description: P. aeruginosa harbors two naturally encoded Beta-lactamase genes, one of which encodes an inducible cephalosporinase and the other of which encodes a constitutively expressed oxacillinase. OXA-50 is a kind of oxacillinase which lead to drug resistance.

References

• Ref 1: Biochemical characterization of the naturally occurring oxacillinase OXA-50 of Pseudomonas aeruginosa. Antimicrob Agents Chemother. 2004 Jun;48(6):2043-8. doi: 10.1128/AAC.48.6.2043-2048.2004.