Molecule Information
General Information of the Molecule (ID: Mol00825)
| Name |
Beta-lactamase (BLA)
,Klebsiella pneumoniae
|
||||
|---|---|---|---|---|---|
| Synonyms |
bla_4; blaOXA-48; G5637_27540; GPZ86_28000; KPE71T_00045; SAMEA3727643_05844
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
bla
|
||||
| Sequence |
MRVLALSAVFLVASIIGMPAVAKEWQENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLK
RANQAFLPASTFKIPNSLIALDLGVVKDEHQVFKWDGQTRDIATWNRDHNLITAMKYSVV PVYQEFARQIGEARMSKMLHAFDYGNEDISGNVDSFWLDGGIRISATEQISFLRKLYHNK LHVSERSQRIVKQAMLTEANGDYIIRAKTGYSTRIEPKIGWWVGWVELDDNVWFFAMNMD MPTSDGLGLRQAITKEVLKQEKIIP Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Penicillin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Klebsiella pneumoniae 11978 | 573 | ||
| Experiment for Molecule Alteration |
DNA sequencing and protein assay | |||
| Experiment for Drug Resistance |
Agar dilution assay | |||
| Mechanism Description | The Beta-lactamase OXA-48 hydrolyzed imipenem at a high level. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Imipenem | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Klebsiella pneumoniae 11978 | 573 | ||
| Experiment for Molecule Alteration |
DNA sequencing and protein assay | |||
| Experiment for Drug Resistance |
Agar dilution assay | |||
| Mechanism Description | The Beta-lactamase OXA-48 hydrolyzed imipenem at a high level. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
