Molecule Information
General Information of the Molecule (ID: Mol00824)
| Name |
Beta-lactamase (BLA)
,Klebsiella pneumoniae
|
||||
|---|---|---|---|---|---|
| Synonyms |
blaCTX-M; blaSHV; blaSHV-5a; blaSHV12; SHV-12; BANRA_05658; BANRA_05677; BANRA_05967; BL124_00006465; C3F39_28925; DN601_29505; IPF_343; IPF_8; pCRE380_11; pCT-KPC_120
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
blaSHV-12
|
||||
| Sequence |
MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADE
RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARG IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Ceftazidime | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Enterobacter cloacae strains ENLA-1 | 550 | ||
| Escherichia coli strain ECAA-1 | 562 | |||
| Escherichia coli strain ECLA-1 | 562 | |||
| Escherichia coli strain ECLA-2 | 562 | |||
| Escherichia coli strain ECLA-4 | 562 | |||
| Escherichia coli strain ECZK-1 | 562 | |||
| Escherichia coli strain ECZP-1 | 562 | |||
| Escherichia coli strain ECZU-1 | 562 | |||
| Escherichia coli strain HK225f | 562 | |||
| Klebsiella pneumoniae strains KPAA-1 | 573 | |||
| Klebsiella pneumoniae strains KPBE-2 | 573 | |||
| Klebsiella pneumoniae strains KPGE-1 | 573 | |||
| Klebsiella pneumoniae strains KPGE-2 | 573 | |||
| Klebsiella pneumoniae strains KPLA-1 | 573 | |||
| Klebsiella pneumoniae strains KPLA-10 | 573 | |||
| Klebsiella pneumoniae strains KPLA-2 | 573 | |||
| Klebsiella pneumoniae strains KPLA-3 | 573 | |||
| Klebsiella pneumoniae strains KPLA-4 | 573 | |||
| Klebsiella pneumoniae strains KPLA-5 | 573 | |||
| Klebsiella pneumoniae strains KPLA-6 | 573 | |||
| Klebsiella pneumoniae strains KPLA-7 | 573 | |||
| Klebsiella pneumoniae strains KPLA-8 | 573 | |||
| Klebsiella pneumoniae strains KPLA-9 | 573 | |||
| Klebsiella pneumoniae strains KPZU-1 | 573 | |||
| Klebsiella pneumoniae strains KPZU-10 | 573 | |||
| Klebsiella pneumoniae strains KPZU-11 | 573 | |||
| Klebsiella pneumoniae strains KPZU-12 | 573 | |||
| Klebsiella pneumoniae strains KPZU-13 | 573 | |||
| Klebsiella pneumoniae strains KPZU-4 | 573 | |||
| Klebsiella pneumoniae strains KPZU-6 | 573 | |||
| Klebsiella pneumoniae strains KPZU-7 | 573 | |||
| Klebsiella pneumoniae strains KPZU-8 | 573 | |||
| Klebsiella pneumoniae strains KPZU-9 | 573 | |||
| Salmonella enterica serotype wien strain SWLA-1 | 149384 | |||
| Salmonella enterica serotype wien strain SWLA-2 | 149384 | |||
| Experiment for Molecule Alteration |
Hybridization experiments assay | |||
| Experiment for Drug Resistance |
Microdilution method assay | |||
| Mechanism Description | Of 60 strains with reduced susceptibility to expanded-spectrum cephalosporins which had been collected, 34 (24Klebsiella pneumoniae, 7Escherichia coli, 1Enterobacter cloacae, and 2Salmonella entericaserotypewien) hybridized with the intragenic blaSHVprobe. TheblaSHVgenes were amplified by PCR, and the presence ofblaSHV-ESBLwas established in 29 strains by restriction enzyme digests of the resulting 1,018-bp amplimers as described elsewhere. These results were confirmed by the nucleotide sequencing of all 34 amplimers. Five strains contained SHV non-ESBL enzymes. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Ceftriaxone | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Enterobacter cloacae strains ENLA-1 | 550 | ||
| Escherichia coli strain ECAA-1 | 562 | |||
| Escherichia coli strain ECLA-1 | 562 | |||
| Escherichia coli strain ECLA-2 | 562 | |||
| Escherichia coli strain ECLA-4 | 562 | |||
| Escherichia coli strain ECZK-1 | 562 | |||
| Escherichia coli strain ECZP-1 | 562 | |||
| Escherichia coli strain ECZU-1 | 562 | |||
| Escherichia coli strain HK225f | 562 | |||
| Klebsiella pneumoniae strains KPAA-1 | 573 | |||
| Klebsiella pneumoniae strains KPBE-2 | 573 | |||
| Klebsiella pneumoniae strains KPGE-1 | 573 | |||
| Klebsiella pneumoniae strains KPGE-2 | 573 | |||
| Klebsiella pneumoniae strains KPLA-1 | 573 | |||
| Klebsiella pneumoniae strains KPLA-10 | 573 | |||
| Klebsiella pneumoniae strains KPLA-2 | 573 | |||
| Klebsiella pneumoniae strains KPLA-3 | 573 | |||
| Klebsiella pneumoniae strains KPLA-4 | 573 | |||
| Klebsiella pneumoniae strains KPLA-5 | 573 | |||
| Klebsiella pneumoniae strains KPLA-6 | 573 | |||
| Klebsiella pneumoniae strains KPLA-7 | 573 | |||
| Klebsiella pneumoniae strains KPLA-8 | 573 | |||
| Klebsiella pneumoniae strains KPLA-9 | 573 | |||
| Klebsiella pneumoniae strains KPZU-1 | 573 | |||
| Klebsiella pneumoniae strains KPZU-10 | 573 | |||
| Klebsiella pneumoniae strains KPZU-11 | 573 | |||
| Klebsiella pneumoniae strains KPZU-12 | 573 | |||
| Klebsiella pneumoniae strains KPZU-13 | 573 | |||
| Klebsiella pneumoniae strains KPZU-4 | 573 | |||
| Klebsiella pneumoniae strains KPZU-6 | 573 | |||
| Klebsiella pneumoniae strains KPZU-7 | 573 | |||
| Klebsiella pneumoniae strains KPZU-8 | 573 | |||
| Klebsiella pneumoniae strains KPZU-9 | 573 | |||
| Salmonella enterica serotype wien strain SWLA-1 | 149384 | |||
| Salmonella enterica serotype wien strain SWLA-2 | 149384 | |||
| Experiment for Molecule Alteration |
Hybridization experiments assay | |||
| Experiment for Drug Resistance |
Microdilution method assay | |||
| Mechanism Description | Of 60 strains with reduced susceptibility to expanded-spectrum cephalosporins which had been collected, 34 (24Klebsiella pneumoniae, 7Escherichia coli, 1Enterobacter cloacae, and 2Salmonella entericaserotypewien) hybridized with the intragenic blaSHVprobe. TheblaSHVgenes were amplified by PCR, and the presence ofblaSHV-ESBLwas established in 29 strains by restriction enzyme digests of the resulting 1,018-bp amplimers as described elsewhere. These results were confirmed by the nucleotide sequencing of all 34 amplimers. Five strains contained SHV non-ESBL enzymes. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
