Molecule Information
General Information of the Molecule (ID: Mol00821)
Name |
Beta-lactamase (BLA)
,Escherichia coli
|
||||
---|---|---|---|---|---|
Synonyms |
bla; bla CTX-M-15; bla CTXM-15; bla_1; bla_2; bla_3; blaCTX-M; blaCTX-M-15; blaCTX-M15; CTX-M-15; A9X72_26855; ACN68_29740; AWP47_17965; BANRA_05422; BJI68_26810; C2121_004650; C2121_005381; CO706_01125; CY655_16075; E3O05_17770; E5P22_18740; E5P33_09365; E5P39_23850; E5P41_23530; E5P42_20460; E5P43_23600; E5P44_23710; E5P45_23695; E5P46_23480; E5P47_23815; E5P48_23485; E5P49_23765; E5P50_24275; E5P51_02965; EA435_19100; EBP16_19885; EBP16_24990; ELT22_08720; ELT25_03215; ELT31_23875; ELT40_25155; ELT41_23005; ELT44_26705; ELT46_06805; ELT48_21595; ELT48_27155; ELT49_23685; ELT54_13870; ELT60_26675; ELT61_26075; ELU83_06515; ELU96_05460; ELU97_00005; ELV01_27290; ELV02_26600; ELV03_26255; ELV04_25750; ELV07_26450; ELV11_23415; ELV13_26970; ELV16_12500; ELV21_22135; ELV23_26085; ELX56_25110; ELX56_26475; ELX70_23835; ELX76_26235; ELX76_27770; ELX79_26345; ELX83_26200; ELX83_26525; ELY24_26875; ELY36_26165; EVY14_26065; EXX13_27820; F0L67_27800; F9B07_28185; FEJ01_19840; FEJ01_27020; G3565_28475; G5603_26845; G5632_10280; G9448_24215; GQE64_24895; GQW07_24060; GQW07_26690; GRO95_23990; GRO95_26745; GRW77_24730; HL601_21620; HL601_27220; HMJ82_28240; HMJ82_29040; HMU48_14165; HMU48_30490; IH772_23850; RCS105_pI0076; RCS46_P0095; RCS53_P0006; RCS57_p0080; RCS59_P0138; RCS67_P0011; SAMEA4363221_00081; SAMEA4370330_00042; SAMEA4370365_00031; SAMEA4370386_00071; SAMEA4370473_00021
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
blaUOE-1
|
||||
Gene ID | |||||
Sequence |
MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ
ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGS GGYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTDGL Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
8 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2], [3] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Amoxicillin | |||
Molecule Alteration | Missense mutation | p.D240G |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH10B | 316385 | ||
Citrobacter freundii 2526/96 | 546 | |||
Escherichia coli isolates | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | We have reported recently the DNA sequence of another Beta-lactamase, CTX- M-15, from Indian enterobacterial isolates that were resistant to both cefotaxime and ceftazidime.CTX-M-15 has a single amino acid change [Asp-240-Gly (Ambler numbering)]7 compared with CTX-M-3. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2], [3] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Cefalotin | |||
Molecule Alteration | Missense mutation | p.D240G |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH10B | 316385 | ||
Citrobacter freundii 2526/96 | 546 | |||
Escherichia coli isolates | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | We have reported recently the DNA sequence of another Beta-lactamase, CTX- M-15, from Indian enterobacterial isolates that were resistant to both cefotaxime and ceftazidime.CTX-M-15 has a single amino acid change [Asp-240-Gly (Ambler numbering)]7 compared with CTX-M-3. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2], [3] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Cefotaxime | |||
Molecule Alteration | Missense mutation | p.D240G |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH10B | 316385 | ||
Citrobacter freundii 2526/96 | 546 | |||
Escherichia coli isolates | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | We have reported recently the DNA sequence of another Beta-lactamase, CTX- M-15, from Indian enterobacterial isolates that were resistant to both cefotaxime and ceftazidime.CTX-M-15 has a single amino acid change [Asp-240-Gly (Ambler numbering)]7 compared with CTX-M-3. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2], [3] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Cefpirome | |||
Molecule Alteration | Missense mutation | p.D240G |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH10B | 316385 | ||
Citrobacter freundii 2526/96 | 546 | |||
Escherichia coli isolates | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | We have reported recently the DNA sequence of another Beta-lactamase, CTX- M-15, from Indian enterobacterial isolates that were resistant to both cefotaxime and ceftazidime.CTX-M-15 has a single amino acid change [Asp-240-Gly (Ambler numbering)]7 compared with CTX-M-3. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2], [3] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Ceftazidime | |||
Molecule Alteration | Missense mutation | p.D240G |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH10B | 316385 | ||
Citrobacter freundii 2526/96 | 546 | |||
Escherichia coli isolates | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | We have reported recently the DNA sequence of another Beta-lactamase, CTX- M-15, from Indian enterobacterial isolates that were resistant to both cefotaxime and ceftazidime.CTX-M-15 has a single amino acid change [Asp-240-Gly (Ambler numbering)]7 compared with CTX-M-3. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2], [3] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Ceftriaxone | |||
Molecule Alteration | Missense mutation | p.D240G |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH10B | 316385 | ||
Citrobacter freundii 2526/96 | 546 | |||
Escherichia coli isolates | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | We have reported recently the DNA sequence of another Beta-lactamase, CTX- M-15, from Indian enterobacterial isolates that were resistant to both cefotaxime and ceftazidime.CTX-M-15 has a single amino acid change [Asp-240-Gly (Ambler numbering)]7 compared with CTX-M-3. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2], [3] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Piperacillin | |||
Molecule Alteration | Missense mutation | p.D240G |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH10B | 316385 | ||
Citrobacter freundii 2526/96 | 546 | |||
Escherichia coli isolates | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | We have reported recently the DNA sequence of another Beta-lactamase, CTX- M-15, from Indian enterobacterial isolates that were resistant to both cefotaxime and ceftazidime.CTX-M-15 has a single amino acid change [Asp-240-Gly (Ambler numbering)]7 compared with CTX-M-3. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2], [3] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Ticarcillin | |||
Molecule Alteration | Missense mutation | p.D240G |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH10B | 316385 | ||
Citrobacter freundii 2526/96 | 546 | |||
Escherichia coli isolates | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | We have reported recently the DNA sequence of another Beta-lactamase, CTX- M-15, from Indian enterobacterial isolates that were resistant to both cefotaxime and ceftazidime.CTX-M-15 has a single amino acid change [Asp-240-Gly (Ambler numbering)]7 compared with CTX-M-3. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.