Molecule Information

General Information of the Molecule (ID: Mol00815)

• Name: Bcr/CflA family efflux transporter (BCML) ,Pseudomonas aeruginosa
• Synonyms: cmlA1; cmlA6; IPC1317_27175
• Molecule Type: Protein
• Gene Name: CmlA6
• Sequence:
  MRSKNFSWRYSLAATVLLLSPFDLLASLGMDMYLPAVPFMPNALGTTASTIQLTLTTYLV
  MIGAGQLLFGPLSDRLGRRPVLLGGGLAYVVASMGLALTSSAEVFLGLRILQACGASACL
  VSTFATVRDIYAGREESNVIYGILGSMLAIVPAVGPLLGALVDMWLGWRAIFAFLGLGMI
  AASAAAWRFWPETRVQRVAGLQWSQLLLPVKCLNFWLYTLCYAAGMGSFFVFFSIAPGLM
  MGRQGVSQLGFSLLFATVAIAMVFTARFMGRVIPKWGSPSVLRMGMGCLIAGAVLLAITE
  IWALQSVLGFIAPMWLVGIGVATAVSVAPNGALRGFDHVAGTVTAVYFCLGGVLLGSIGT
  LIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRVKGSRGQGEHDVVALQSAESTSNPNR
• Uniprot ID: Q933G9_PSEAI

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Pseudomonas aeruginosa infection [1]

• Resistant Disease: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH10B; 316385
• In Vitro Model: Pseudomonas aeruginosa PU21; 287
• In Vitro Model: Escherichia coli strain k-12 C600; 83333
• In Vitro Model: Pseudomonas aeruginosa 104116; 287
• In Vitro Model: Pseudomonas aeruginosa SOF-1; 287
• Experiment for Molecule Alteration: Southern technique assay
• Experiment for Drug Resistance: Agar dilution technique assay
• Mechanism Description: An additional ORF located downstream corresponded to a cmlA-like gene that encodes CMLA6 for chloramphenicol resistance and that shared 99% amino acid identity with CMLA1, with only three amino acid changes.

References

• Ref 1: Oxacillinase-mediated resistance to cefepime and susceptibility to ceftazidime in Pseudomonas aeruginosa. Antimicrob Agents Chemother. 2001 Jun;45(6):1615-20. doi: 10.1128/AAC.45.6.1615-1620.2001.