Molecule Information
General Information of the Molecule (ID: Mol00814)
| Name |
Bcr/CflA family efflux transporter (BCML)
,Klebsiella pneumoniae
|
||||
|---|---|---|---|---|---|
| Molecule Type |
Protein
|
||||
| Gene Name |
cmlA4
|
||||
| Sequence |
MRSKNFSWRYSLAATVLLLSPFDLLASLGMDMYLPAVPFMPNALGTTASTVQLTLATYLV
MIGAGQLLFGPLSDRLGRRPVLLGGGLAYVVASMGLAFTSLAEVFLGLRILQACGASACL VSTFATVRDIYAGREESNVIYGILGSMLAMVPAVGPLLGALVDMWLGWRAIFAFLGLGMI AASAAAWRFWPETRVQRVTGLQWSQLLLPVKCLNFWLYTLCYAAGMGSFFVFFFIAPGLI MGRQGVSQLGFSLLFATVAIAMVFTARFMGRVIPKWGSPSVLRMGMGCLIAGAVLLAITE IWASQSVLGFIAPMWLVGIGVATAVSVAPNGALQGFDHVAGTVTAVYFCLGGVLLGSIGT LIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRAKGSRGQGEHDVVALQSAESTSNPNR Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
11 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Amoxicillin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Klebsiella pneumoniae ORI-1 strain harbored a ca. 140-kb nontransferable plasmid, pTk1, that conferred an extended-spectrum cephalosporin resistance profile antagonized by the addition of clavulanic acid, tazobactam, or imipenem. The gene for GES-1 (Guiana extended-spectrum beta-lactamase) was cloned, and its protein was expressed in Escherichia coli DH10B, where this pI-5. 8 beta-lactamase of a ca. 31-kDa molecular mass conferred resistance to oxyimino cephalosporins (mostly to ceftazidime). GES-1 is weakly related to the other plasmid-located Ambler class A extended-spectrum beta-lactamases (ESBLs). | |||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Amoxicillin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Beta-Lactam MICs for k. pneumoniae ORI-1 and Escherichia coli DH10B harboring either the natural plasmid pTk1 or the recombinant plasmid pC1 were somewhat similar and might indicate the presence of an ESBL. In all cases, the ceftazidime MICs were higher than those of cefotaxime and aztreonam. Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Sensitive Drug | Amoxicillin | |||
| Molecule Alteration | Expression | Antagonism |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Inhibition studies, as measured by IC50 values with benzylpenicillin as the substrate, showed that GES-1 was inhibited by clavulanic acid (5 uM) and tazobactam (2.5 uM) and strongly inhibited by imipenem (0.1 uM). Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Benzylpenicillin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Klebsiella pneumoniae ORI-1 strain harbored a ca. 140-kb nontransferable plasmid, pTk1, that conferred an extended-spectrum cephalosporin resistance profile antagonized by the addition of clavulanic acid, tazobactam, or imipenem. The gene for GES-1 (Guiana extended-spectrum beta-lactamase) was cloned, and its protein was expressed in Escherichia coli DH10B, where this pI-5. 8 beta-lactamase of a ca. 31-kDa molecular mass conferred resistance to oxyimino cephalosporins (mostly to ceftazidime). GES-1 is weakly related to the other plasmid-located Ambler class A extended-spectrum beta-lactamases (ESBLs). | |||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Benzylpenicillin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Beta-Lactam MICs for k. pneumoniae ORI-1 and Escherichia coli DH10B harboring either the natural plasmid pTk1 or the recombinant plasmid pC1 were somewhat similar and might indicate the presence of an ESBL. In all cases, the ceftazidime MICs were higher than those of cefotaxime and aztreonam. Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Sensitive Drug | Benzylpenicillin | |||
| Molecule Alteration | Expression | Antagonism |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Inhibition studies, as measured by IC50 values with benzylpenicillin as the substrate, showed that GES-1 was inhibited by clavulanic acid (5 uM) and tazobactam (2.5 uM) and strongly inhibited by imipenem (0.1 uM). Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Cefalotin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Klebsiella pneumoniae ORI-1 strain harbored a ca. 140-kb nontransferable plasmid, pTk1, that conferred an extended-spectrum cephalosporin resistance profile antagonized by the addition of clavulanic acid, tazobactam, or imipenem. The gene for GES-1 (Guiana extended-spectrum beta-lactamase) was cloned, and its protein was expressed in Escherichia coli DH10B, where this pI-5. 8 beta-lactamase of a ca. 31-kDa molecular mass conferred resistance to oxyimino cephalosporins (mostly to ceftazidime). GES-1 is weakly related to the other plasmid-located Ambler class A extended-spectrum beta-lactamases (ESBLs). | |||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Cefalotin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Beta-Lactam MICs for k. pneumoniae ORI-1 and Escherichia coli DH10B harboring either the natural plasmid pTk1 or the recombinant plasmid pC1 were somewhat similar and might indicate the presence of an ESBL. In all cases, the ceftazidime MICs were higher than those of cefotaxime and aztreonam. Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Sensitive Drug | Cefalotin | |||
| Molecule Alteration | Expression | Antagonism |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Inhibition studies, as measured by IC50 values with benzylpenicillin as the substrate, showed that GES-1 was inhibited by clavulanic acid (5 uM) and tazobactam (2.5 uM) and strongly inhibited by imipenem (0.1 uM). Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Cefepime | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Klebsiella pneumoniae ORI-1 strain harbored a ca. 140-kb nontransferable plasmid, pTk1, that conferred an extended-spectrum cephalosporin resistance profile antagonized by the addition of clavulanic acid, tazobactam, or imipenem. The gene for GES-1 (Guiana extended-spectrum beta-lactamase) was cloned, and its protein was expressed in Escherichia coli DH10B, where this pI-5. 8 beta-lactamase of a ca. 31-kDa molecular mass conferred resistance to oxyimino cephalosporins (mostly to ceftazidime). GES-1 is weakly related to the other plasmid-located Ambler class A extended-spectrum beta-lactamases (ESBLs). | |||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Cefepime | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Beta-Lactam MICs for k. pneumoniae ORI-1 and Escherichia coli DH10B harboring either the natural plasmid pTk1 or the recombinant plasmid pC1 were somewhat similar and might indicate the presence of an ESBL. In all cases, the ceftazidime MICs were higher than those of cefotaxime and aztreonam. Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Sensitive Drug | Cefepime | |||
| Molecule Alteration | Expression | Antagonism |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Inhibition studies, as measured by IC50 values with benzylpenicillin as the substrate, showed that GES-1 was inhibited by clavulanic acid (5 uM) and tazobactam (2.5 uM) and strongly inhibited by imipenem (0.1 uM). Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Cefotaxime | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Klebsiella pneumoniae ORI-1 strain harbored a ca. 140-kb nontransferable plasmid, pTk1, that conferred an extended-spectrum cephalosporin resistance profile antagonized by the addition of clavulanic acid, tazobactam, or imipenem. The gene for GES-1 (Guiana extended-spectrum beta-lactamase) was cloned, and its protein was expressed in Escherichia coli DH10B, where this pI-5. 8 beta-lactamase of a ca. 31-kDa molecular mass conferred resistance to oxyimino cephalosporins (mostly to ceftazidime). GES-1 is weakly related to the other plasmid-located Ambler class A extended-spectrum beta-lactamases (ESBLs). | |||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Cefotaxime | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Beta-Lactam MICs for k. pneumoniae ORI-1 and Escherichia coli DH10B harboring either the natural plasmid pTk1 or the recombinant plasmid pC1 were somewhat similar and might indicate the presence of an ESBL. In all cases, the ceftazidime MICs were higher than those of cefotaxime and aztreonam. Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Sensitive Drug | Cefotaxime | |||
| Molecule Alteration | Expression | Antagonism |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Inhibition studies, as measured by IC50 values with benzylpenicillin as the substrate, showed that GES-1 was inhibited by clavulanic acid (5 uM) and tazobactam (2.5 uM) and strongly inhibited by imipenem (0.1 uM). Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Cefoxitin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Klebsiella pneumoniae ORI-1 strain harbored a ca. 140-kb nontransferable plasmid, pTk1, that conferred an extended-spectrum cephalosporin resistance profile antagonized by the addition of clavulanic acid, tazobactam, or imipenem. The gene for GES-1 (Guiana extended-spectrum beta-lactamase) was cloned, and its protein was expressed in Escherichia coli DH10B, where this pI-5. 8 beta-lactamase of a ca. 31-kDa molecular mass conferred resistance to oxyimino cephalosporins (mostly to ceftazidime). GES-1 is weakly related to the other plasmid-located Ambler class A extended-spectrum beta-lactamases (ESBLs). | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Sensitive Drug | Cefoxitin | |||
| Molecule Alteration | Expression | Antagonism |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Inhibition studies, as measured by IC50 values with benzylpenicillin as the substrate, showed that GES-1 was inhibited by clavulanic acid (5 uM) and tazobactam (2.5 uM) and strongly inhibited by imipenem (0.1 uM). Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Ceftazidime | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Klebsiella pneumoniae ORI-1 strain harbored a ca. 140-kb nontransferable plasmid, pTk1, that conferred an extended-spectrum cephalosporin resistance profile antagonized by the addition of clavulanic acid, tazobactam, or imipenem. The gene for GES-1 (Guiana extended-spectrum beta-lactamase) was cloned, and its protein was expressed in Escherichia coli DH10B, where this pI-5. 8 beta-lactamase of a ca. 31-kDa molecular mass conferred resistance to oxyimino cephalosporins (mostly to ceftazidime). GES-1 is weakly related to the other plasmid-located Ambler class A extended-spectrum beta-lactamases (ESBLs). | |||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Ceftazidime | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Beta-Lactam MICs for k. pneumoniae ORI-1 and Escherichia coli DH10B harboring either the natural plasmid pTk1 or the recombinant plasmid pC1 were somewhat similar and might indicate the presence of an ESBL. In all cases, the ceftazidime MICs were higher than those of cefotaxime and aztreonam. Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Sensitive Drug | Ceftazidime | |||
| Molecule Alteration | Expression | Antagonism |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Inhibition studies, as measured by IC50 values with benzylpenicillin as the substrate, showed that GES-1 was inhibited by clavulanic acid (5 uM) and tazobactam (2.5 uM) and strongly inhibited by imipenem (0.1 uM). Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Cephaloridine | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Klebsiella pneumoniae ORI-1 strain harbored a ca. 140-kb nontransferable plasmid, pTk1, that conferred an extended-spectrum cephalosporin resistance profile antagonized by the addition of clavulanic acid, tazobactam, or imipenem. The gene for GES-1 (Guiana extended-spectrum beta-lactamase) was cloned, and its protein was expressed in Escherichia coli DH10B, where this pI-5. 8 beta-lactamase of a ca. 31-kDa molecular mass conferred resistance to oxyimino cephalosporins (mostly to ceftazidime). GES-1 is weakly related to the other plasmid-located Ambler class A extended-spectrum beta-lactamases (ESBLs). | |||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Cephaloridine | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Beta-Lactam MICs for k. pneumoniae ORI-1 and Escherichia coli DH10B harboring either the natural plasmid pTk1 or the recombinant plasmid pC1 were somewhat similar and might indicate the presence of an ESBL. In all cases, the ceftazidime MICs were higher than those of cefotaxime and aztreonam. Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Sensitive Drug | Cephaloridine | |||
| Molecule Alteration | Expression | Antagonism |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Inhibition studies, as measured by IC50 values with benzylpenicillin as the substrate, showed that GES-1 was inhibited by clavulanic acid (5 uM) and tazobactam (2.5 uM) and strongly inhibited by imipenem (0.1 uM). Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Like CMLA1, this novel protein (CMLA4) likely conferred resistance to chloramphenicol by a nonenzymatic mechanism. Among the 207 bp upstream of cmlA4, only four nucleotide changes were identified, compared to the sequence found upstream of cmlA1 (data not shown). Downstream from cmlA4, an inverse core site (GCCCAAC) was part of a composite 59-be of 70 bp. This 59-be was almost 100% identical to the downstream region of cmlA1, except for one nucleotide change (T to C in cmlA4) at the last position (position 4,997). | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Piperacillin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Klebsiella pneumoniae ORI-1 strain harbored a ca. 140-kb nontransferable plasmid, pTk1, that conferred an extended-spectrum cephalosporin resistance profile antagonized by the addition of clavulanic acid, tazobactam, or imipenem. The gene for GES-1 (Guiana extended-spectrum beta-lactamase) was cloned, and its protein was expressed in Escherichia coli DH10B, where this pI-5. 8 beta-lactamase of a ca. 31-kDa molecular mass conferred resistance to oxyimino cephalosporins (mostly to ceftazidime). GES-1 is weakly related to the other plasmid-located Ambler class A extended-spectrum beta-lactamases (ESBLs). | |||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Piperacillin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Beta-Lactam MICs for k. pneumoniae ORI-1 and Escherichia coli DH10B harboring either the natural plasmid pTk1 or the recombinant plasmid pC1 were somewhat similar and might indicate the presence of an ESBL. In all cases, the ceftazidime MICs were higher than those of cefotaxime and aztreonam. Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Sensitive Drug | Piperacillin | |||
| Molecule Alteration | Expression | Antagonism |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Inhibition studies, as measured by IC50 values with benzylpenicillin as the substrate, showed that GES-1 was inhibited by clavulanic acid (5 uM) and tazobactam (2.5 uM) and strongly inhibited by imipenem (0.1 uM). Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Ticarcillin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Klebsiella pneumoniae ORI-1 strain harbored a ca. 140-kb nontransferable plasmid, pTk1, that conferred an extended-spectrum cephalosporin resistance profile antagonized by the addition of clavulanic acid, tazobactam, or imipenem. The gene for GES-1 (Guiana extended-spectrum beta-lactamase) was cloned, and its protein was expressed in Escherichia coli DH10B, where this pI-5. 8 beta-lactamase of a ca. 31-kDa molecular mass conferred resistance to oxyimino cephalosporins (mostly to ceftazidime). GES-1 is weakly related to the other plasmid-located Ambler class A extended-spectrum beta-lactamases (ESBLs). | |||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Ticarcillin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Beta-Lactam MICs for k. pneumoniae ORI-1 and Escherichia coli DH10B harboring either the natural plasmid pTk1 or the recombinant plasmid pC1 were somewhat similar and might indicate the presence of an ESBL. In all cases, the ceftazidime MICs were higher than those of cefotaxime and aztreonam. Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Sensitive Drug | Ticarcillin | |||
| Molecule Alteration | Expression | Antagonism |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH10B | 316385 | ||
| Escherichia coli strain NCTC 50192 | 562 | |||
| Klebsiella pneumoniae strain ORI-1 | 573 | |||
| Experiment for Molecule Alteration |
PCR and hybridization experiments assay | |||
| Experiment for Drug Resistance |
Agar dilution technique assay | |||
| Mechanism Description | Inhibition studies, as measured by IC50 values with benzylpenicillin as the substrate, showed that GES-1 was inhibited by clavulanic acid (5 uM) and tazobactam (2.5 uM) and strongly inhibited by imipenem (0.1 uM). Beta-Lactam MICs were always lowered by the addition of clavulanic acid or tazobactam, less so by sulbactam, and uncommonly by imipenem. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
