Molecule Information

General Information of the Molecule (ID: Mol00813)

• Name: Bcr/CflA family efflux transporter (BCML) ,Klebsiella aerogenes
• Molecule Type: Protein
• Gene Name: cmlB
• Sequence:
  MRSKNCNWRYSLAVTVLLLSPFDLLASLGMDMYLPAVPFMPHALGTTAGTIQLTLTTYLV
  MIGAGQLLFGPLSDRLGRRPVLLAGGAAYVAASIGLVVTSSAGVFLGFRILQACGASACL
  VATFATVRDIYAGRKESNVIYGLLGSMLAMVPAIGPLLGAVIDTWFGWRAIFAFLGLGMI
  AALTAAWRLWPETRVQRPAALQWSQLLLPIKHLNFWLYTVCYAAGMGSFFVFFSIAPGLM
  MGRQGMSQFGFSLLFATVAIAMMLAARFMGRVIAKWGSLSALRMGMGCLIAGAVLLVITE
  LWIPQSVLGFIAPMWLVGVGVATAVSVAPNGALRGFDHIAGAVTAVYFCLGGLLLGSVGT
  LIISLLPRDTAWPVIAYCLVLATIVLGLSCVSRARDLRGHGEYDAVART
• Uniprot ID: Q9X2P0_KLEAE

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Klebsiella
Species: Klebsiella aerogenes

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Enterobacter aerogenes infection [1]

• Resistant Disease: Enterobacter aerogenes infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli JM83; 562
• In Vitro Model: Enterobacter aerogenes strain; 548
• In Vitro Model: Enterobacter aerogenes strain BM2688; 548
• In Vitro Model: Enterobacter aerogenes strain BM2688-1; 548
• In Vitro Model: Escherichia coli strain J5-3; 562
• Experiment for Molecule Alteration: Southern hybridization assay
• Experiment for Drug Resistance: Disk diffusion assay
• Mechanism Description: A putative GTG initiation codon at position 718 was preceded at 8 bp by a RBS-like sequence. This coding sequence, designated cmlA2, shared 83.7% identity with the cmlA1 gene of the class 1 integron In4 in Tn1696 which confers nonenzymatic chloramphenicol resistance.

References

• Ref 1: Characterization of In40 of Enterobacter aerogenes BM2688, a class 1 integron with two new gene cassettes, cmlA2 and qacF. Antimicrob Agents Chemother. 1998 Oct;42(10):2557-63. doi: 10.1128/AAC.42.10.2557.