Molecule Information
      General Information of the Molecule (ID: Mol00811)
  
  | Name | Bacitracin transport ATP-binding protein BcrA (BCRA)
                                ,Bacillus licheniformis
                               | ||||
|---|---|---|---|---|---|
| Molecule Type | Protein | ||||
| Gene Name | bcrA | ||||
| Sequence | MSTIIKTTDLTKMYGSQKSVDHLNINVKQGDIYGFLGRNGAGKTTTIRMLLGLIKPTSGQ IEIFGENFFKNKKEILRRIGSIVEVPGFYANLTARENLLINAKIIGIHKKNAIDEVLEIV GLQHETKKLVGKFSLGMKQRLGIARALLHYPELLILDEPTNGLDPIGIKEMRRLIHSLAK ERNITIFISSHILSEIEQLVDHVGIIHEGKLLEEIPFDHLKKRNRKYLEFQLSDQNKAVV LMEQHFDIHDYEVHQDGIIRVYSHLGQQGKLNKLFVENGIDVLKITMSEDSLEDYFVKLI GGGTIG     Click to Show/Hide | ||||
| Function | Part of the binding-protein-dependent transport system for bacitracin that confer resistance to this antibiotic. Probably responsible for energy coupling to the transport system (By similarity).     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      3 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacillus licheniformis infection | [1] | |||
| Resistant Disease | Bacillus licheniformis infection [ICD-11: 1C4Y.2] | |||
| Resistant Drug | Bacitracin A | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain HB101 | 634468 | ||
| Escherichia coli strain DH5alpha | 668369 | |||
| Bacillus subtilis strain 1A685 | 1423 | |||
| Bacillus subtilis strain vectors pHV143 | 1423 | |||
| Bacillus ticheniformis strain FD | 1402 | |||
| Experiment for Molecule Alteration | Dideoxynucleotide chain-termination method assay | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | How could the proposed export function of the Bcr permease account for the bacitracin resistance The transported molecule could be either the substance inactivating the antibiotic or the antibiotic alone. As already observed. some of the metabolites could inhibit the bactericidal activity of bacitracin at very low concentrations. However, in S. subfitis and Escherichia coli strains carrying cloned bcr genes, no substances that could suppress bacitracin activity were detected. It seems that the bacitracin is indeed the target of the Bcr ABC transporter. | |||
| Disease Class: Escherichia coli infection | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Bacitracin A | |||
| Molecule Alteration | Expression | Acquired | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain HB101 | 634468 | ||
| Escherichia coli strain DH5alpha | 668369 | |||
| Bacillus subtilis strain 1A685 | 1423 | |||
| Bacillus subtilis strain vectors pHV143 | 1423 | |||
| Bacillus ticheniformis strain FD | 1402 | |||
| Experiment for Molecule Alteration | Dideoxynucleotide chain-termination method assay | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli. | |||
| Disease Class: Bacillus subtilis infection | [1] | |||
| Resistant Disease | Bacillus subtilis infection [ICD-11: 1G40.1] | |||
| Resistant Drug | Bacitracin A | |||
| Molecule Alteration | Expression | Acquired | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain HB101 | 634468 | ||
| Escherichia coli strain DH5alpha | 668369 | |||
| Bacillus subtilis strain 1A685 | 1423 | |||
| Bacillus subtilis strain vectors pHV143 | 1423 | |||
| Bacillus ticheniformis strain FD | 1402 | |||
| Experiment for Molecule Alteration | Dideoxynucleotide chain-termination method assay | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacillus licheniformis infection | [1] | |||
| Resistant Disease | Bacillus licheniformis infection [ICD-11: 1C4Y.2] | |||
| Resistant Drug | Bacitracin F | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain HB101 | 634468 | ||
| Escherichia coli strain DH5alpha | 668369 | |||
| Bacillus subtilis strain 1A685 | 1423 | |||
| Bacillus subtilis strain vectors pHV143 | 1423 | |||
| Bacillus ticheniformis strain FD | 1402 | |||
| Experiment for Molecule Alteration | Dideoxynucleotide chain-termination method assay | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | How could the proposed export function of the Bcr permease account for the bacitracin resistance The transported molecule could be either the substance inactivating the antibiotic or the antibiotic alone. As already observed. some of the metabolites could inhibit the bactericidal activity of bacitracin at very low concentrations. However, in S. subfitis and Escherichia coli strains carrying cloned bcr genes, no substances that could suppress bacitracin activity were detected. It seems that the bacitracin is indeed the target of the Bcr ABC transporter. | |||
| Disease Class: Escherichia coli infection | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Bacitracin F | |||
| Molecule Alteration | Expression | Acquired | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain HB101 | 634468 | ||
| Escherichia coli strain DH5alpha | 668369 | |||
| Bacillus subtilis strain 1A685 | 1423 | |||
| Bacillus subtilis strain vectors pHV143 | 1423 | |||
| Bacillus ticheniformis strain FD | 1402 | |||
| Experiment for Molecule Alteration | Dideoxynucleotide chain-termination method assay | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli. | |||
| Disease Class: Bacillus subtilis infection | [1] | |||
| Resistant Disease | Bacillus subtilis infection [ICD-11: 1G40.1] | |||
| Resistant Drug | Bacitracin F | |||
| Molecule Alteration | Expression | Acquired | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain HB101 | 634468 | ||
| Escherichia coli strain DH5alpha | 668369 | |||
| Bacillus subtilis strain 1A685 | 1423 | |||
| Bacillus subtilis strain vectors pHV143 | 1423 | |||
| Bacillus ticheniformis strain FD | 1402 | |||
| Experiment for Molecule Alteration | Dideoxynucleotide chain-termination method assay | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacillus licheniformis infection | [1] | |||
| Resistant Disease | Bacillus licheniformis infection [ICD-11: 1C4Y.2] | |||
| Resistant Drug | Bacitracin methylene disalicylate | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain HB101 | 634468 | ||
| Escherichia coli strain DH5alpha | 668369 | |||
| Bacillus subtilis strain 1A685 | 1423 | |||
| Bacillus subtilis strain vectors pHV143 | 1423 | |||
| Bacillus ticheniformis strain FD | 1402 | |||
| Experiment for Molecule Alteration | Dideoxynucleotide chain-termination method assay | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | How could the proposed export function of the Bcr permease account for the bacitracin resistance The transported molecule could be either the substance inactivating the antibiotic or the antibiotic alone. As already observed. some of the metabolites could inhibit the bactericidal activity of bacitracin at very low concentrations. However, in S. subfitis and Escherichia coli strains carrying cloned bcr genes, no substances that could suppress bacitracin activity were detected. It seems that the bacitracin is indeed the target of the Bcr ABC transporter. | |||
| Disease Class: Escherichia coli infection | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Bacitracin methylene disalicylate | |||
| Molecule Alteration | Expression | Acquired | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain HB101 | 634468 | ||
| Escherichia coli strain DH5alpha | 668369 | |||
| Bacillus subtilis strain 1A685 | 1423 | |||
| Bacillus subtilis strain vectors pHV143 | 1423 | |||
| Bacillus ticheniformis strain FD | 1402 | |||
| Experiment for Molecule Alteration | Dideoxynucleotide chain-termination method assay | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli. | |||
| Disease Class: Bacillus subtilis infection | [1] | |||
| Resistant Disease | Bacillus subtilis infection [ICD-11: 1G40.1] | |||
| Resistant Drug | Bacitracin methylene disalicylate | |||
| Molecule Alteration | Expression | Acquired | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli strain HB101 | 634468 | ||
| Escherichia coli strain DH5alpha | 668369 | |||
| Bacillus subtilis strain 1A685 | 1423 | |||
| Bacillus subtilis strain vectors pHV143 | 1423 | |||
| Bacillus ticheniformis strain FD | 1402 | |||
| Experiment for Molecule Alteration | Dideoxynucleotide chain-termination method assay | |||
| Experiment for Drug Resistance | MIC assay | |||
| Mechanism Description | The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
