General Information of the Molecule (ID: Mol00808)
Name
ATP-binding protein (ABP) ,Streptomyces antibioticus
Synonyms
oleC-ORF4; ATP-binding protein
    Click to Show/Hide
Molecule Type
Protein
Gene Name
oleC-ORF4
Sequence
MTVRGLVKHYGETKALDGVDLDVREGTVMGVLGPNGAGKTTLVRILSTLITPDSGQATVA
GYDVVRQPRQLRRVIGLTGQYASVDEKLPGWENLYLIGRLLDLSRKEARARADELLERFS
LTEAARRPAGTYSGGMRRRLDLAASMIGRPAVLYLDEPTTGLDPRTRNEVWDEVKAMVGD
GVTVLLTTQYMEEAEQLASELTVVDRGRVIAKGGIEELKARVGGRTLRVRPVDPLQLRPL
AGMLDELGITGLASTTVDTETGALLVPILSDEQLTAVVGAVTARGITLSSITTELPSLDE
VFLSLTGHRASAPQDAEPARQEVAV
    Click to Show/Hide
Uniprot ID
Q53716_STRAT
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces antibioticus
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Matromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Streptomyces antibioticus infection [ICD-11: 1C43.1] [1]
Resistant Disease Streptomyces antibioticus infection [ICD-11: 1C43.1]
Resistant Drug Matromycin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Streptomyces albus J1074 457425
Streptomyces lividans strain Tk21 1916
Escherichia coli strain ED8767 562
Escherichia coli strain TGI 83333
Streptomyces antibioticu strain ATCC 11891 1890
Experiment for
Molecule Alteration
DNA hybridizations assay
Mechanism Description Three different DNA fragments of an oleandomycin producer, Streptomyces antibioticus, conferring oleandomycin resistance were cloned in plasmid pIJ702 and expressed in Streptomyces lividans and in Streptomyces albus. These oleandomycin resistance determinants were designated as oleA (pOR400), oleB (pOR501) and oleC (pOR800). The oleC (orf4) gene product had a hydrophilic profile and showed important similarity with proteins containing typical ATP-binding domains characteristic of the ABC-transporter superfamily and involved in membrane transport and, particularly, with several genes conferring resistance to various macrolide antibiotics and anticancer drugs.
References
Ref 1 Streptomyces antibioticus contains at least three oleandomycin-resistance determinants, one of which shows similarity with proteins of the ABC-transporter superfamily. Mol Microbiol. 1993 May;8(3):571-82. doi: 10.1111/j.1365-2958.1993.tb01601.x.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.