General Information of the Molecule (ID: Mol00807)
Name
ATP-binding cassette transporter A (ABCA) ,Staphylococcus aureus
Synonyms
abcA; AbcA
    Click to Show/Hide
Molecule Type
Protein
Gene Name
abcA
Sequence
MKRENPLFFLFKKLSWPVGLIVAAITISSLGSLSGLLVPLFTGRIVDKFSVSHINWNLIA
LFGGIFVINALLSGLGLYLLSKIGEKIIYRIRSVLWEHIIQLKMPFFDKNESGQLMSRLT
DDTKVINEFISQKLPNLLPSIVTLVGSLIMLFILDWKMTLLTFITIPIFVLIMIPLGRIM
QKISTSTQSEIANFSGLLGRVLTEMRLVKISNTERLELDNAHKNLNEIYKLGLKQAKIAA
VVQPISGIVMLLTIAIILGFGALEIATGAITAGTLIAMIFYVIQLSMPLINLSTLVTDYK
KAVGASSRIYEIMQEPIEPTEALEDSENVLIDDGVLSFEHVDFKYDVKKILDDVSFQIPQ
GQVSAFVGPSGSGKSTIFNLIERMYEIESGDIKYGLESVYDIPLSKWRRKIGYVMQSNSM
MSGTIRDNILYGINRHVSDEELINYAKLANCHDFIMQFDEGYDTLVGERGLKLSGGQRQR
IDIARSFVKNPDILLLDEATANLDSESELKIQEALETLMEGRTTIVIRDRLSTLKKPVKL
CGLDKGQVTGKGTHSELMASHAKYKNFVVSQKLTD
    Click to Show/Hide
Function
May be involved in multidrug export. Transmembrane domains (TMD) form a pore in the cell membrane and the ATP-binding domain (NBD) is responsible for energy generation.
    Click to Show/Hide
Uniprot ID
Q53614_STAAU
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Staphylococcaceae
Genus: Staphylococcus
Species: Staphylococcus aureus
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Daptomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Daptomycin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus MW2 1242971
In Vivo Model Swiss webster male mice model Mus musculus
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description The ATP-dependent transporter gene abcA in Staphylococcus aureus confers resistance to hydrophobic Beta-lactams.
Disease Class: Bacteremia [1], [2], [3]
Resistant Disease Bacteremia [ICD-11: MA15.0]
Resistant Drug Daptomycin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus MW2 1242971
In Vivo Model Swiss webster male mice model Mus musculus
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description The ATP-dependent transporter gene abcA in Staphylococcus aureus confers resistance to hydrophobic Beta-lactams.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Moenomycin A
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Moenomycin A
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus MW2 1242971
In Vivo Model Swiss webster male mice model Mus musculus
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description The ATP-dependent transporter gene abcA in Staphylococcus aureus confers resistance to hydrophobic Beta-lactams.
Disease Class: Bacteremia [1], [2], [3]
Resistant Disease Bacteremia [ICD-11: MA15.0]
Resistant Drug Moenomycin A
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Staphylococcus aureus MW2 1242971
In Vivo Model Swiss webster male mice model Mus musculus
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description The ATP-dependent transporter gene abcA in Staphylococcus aureus confers resistance to hydrophobic Beta-lactams.
References
Ref 1 Regulation of antibiotic resistance in Staphylococcus aureus. Int J Med Microbiol. 2010 Feb;300(2-3):118-29. doi: 10.1016/j.ijmm.2009.08.015. Epub 2009 Oct 2.
Ref 2 Regulation of expression of abcA and its response to environmental conditions. J Bacteriol. 2014 Apr;196(8):1532-9. doi: 10.1128/JB.01406-13. Epub 2014 Feb 7.
Ref 3 Multidrug-Resistance Transporter AbcA Secretes Staphylococcus aureus Cytolytic Toxins. J Infect Dis. 2016 Jan 15;213(2):295-304. doi: 10.1093/infdis/jiv376. Epub 2015 Jul 9.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.