Molecule Information
      General Information of the Molecule (ID: Mol00802)
  
  | Name | Aminoglycoside phosphotransferase (APH)
                                ,Enterococcus faecium
                               | ||||
|---|---|---|---|---|---|
| Synonyms | aph(2')-Ib; Aminoglycoside phosphotransferase     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | aph(2')-Ib | ||||
| Sequence | MVNLDAEIYEHLNKQIKINELRYLSSGDDSDTFLCNEQYVVKVPKRDSVRISQKREFELY RFLENCKLSYQIPAVVYQSDRFNIMKYIKGERITYEQYHKLSEKEKDALAYDEATFLKEL HSIEIDCSVSLFSDALVNKKDKFLQDKKLLISILEKEQLLTDEMLEHIETIYENILNNAV LFKYTPCLVHNDFSANNMIFRNNRLFGVIDFGDFNVGDPDNDFLCLLDCSTDDFGKEFGR KVLKYYQHKAPEVAERKAELNDVYWSIDQIIYGYERKDREMLIKGVSELLQTQAEMFIF     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Enterococcus faecium meningitis | [1] | |||
| Resistant Disease | Enterococcus faecium meningitis [ICD-11: 1D01.2] | |||
| Resistant Drug | Plazomicin | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Enterococcus faecium SF11770 | 1352 | ||
| Escherichia coli kHE5-2a | 562 | |||
| Escherichia coli strain DH10b(pMW119) | 316385 | |||
| Experiment for Molecule Alteration | PCR | |||
| Mechanism Description | High-level gentamicin resistance (MIC >= 500 ug/ml) in enterococci is predominantly mediated by aac(6')-Ie-aph(2")-Ia, which encodes the bifunctional aminoglycoside-modifying enzyme AAC(6')-APH(2"). Found less commonly is aph(2")-Id, another gene recently reported to be associated with high-level gentamicin resistance in enterococci. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
