Molecule Information
General Information of the Molecule (ID: Mol00797)
Name |
Aminoglycoside N(3)-acetyltransferase (A3AC)
,Escherichia coli
|
||||
---|---|---|---|---|---|
Synonyms |
aac(3); aac(3)-IV; aac(3)-IVa; aac(3)IV; aac3-VI; BJJ90_27515; BMC79_004910; BMC79_005421; BVL39_27730; BZL69_29365; CDC27_25895; CR538_26885; CWS33_26775; D0X26_29340; D9D77_25705; D9D77_28900; D9E49_23800; D9E49_28790; E4K51_25065; F3N40_24255; F3N40_27730; GTP88_26100; GTP88_26800; HNC66_26125; HNC66_27870; HND12_28675; HND12_30655; HVX16_26725; J0541_005607; J0541_005921; pEC012_00026; SAMEA3472080_05397
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aacC4
|
||||
Sequence |
MQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRPLEDGPLGLIEALRAALGPGGTLVM
PSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNVKRSAHPFAFAAAGPQAEQIISDPLP LPPHSPASPVARVHELDGQVLLLGVGHDANTTLHLAELMAKVPYGVPRHCTILQDGKLVR VDYLENDHCCERFALADRWLKEKSLQKEGPVGHAFARLIRSRDIVATALGQLGRDPLIFL HPPEAGCEECDAARQSIG Click to Show/Hide
|
||||
Function |
Resistance to antibiotics containing the 2-deoxy-streptamine ring including gentamicin, kanamycin, tobramycin, neomycin and apramycin.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Gentamicin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli Co227 | 562 | ||
Escherichia coli Co228 | 562 | |||
Escherichia coli Co356 | 562 | |||
Experiment for Molecule Alteration |
PCR; PCR-restriction fragment length polymorphism analysis; Sequencing assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Multiple-antibiotic-resistant phenotype is associated with gene mutation and mar locus regulation. |
Clinical Trial Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [2] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Apramycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli strain BE904 | 562 | ||
Escherichia coli strain CSR603 | 562 | |||
Escherichia coli strain DH1 | 536056 | |||
Escherichia coli strain JA221 | 562 | |||
Escherichia coli strain k12 | 83333 | |||
Escherichia coli strain RR1 | 562 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
O-galactosidase assay | |||
Mechanism Description | Apramycin resistance is mediated by an aminocyclitol acetyltransferase that acetylates the nitrogen at the 3 -position of apramycin.The gene is abbreviated as aac(3)Iv. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.