Molecule Information

General Information of the Molecule (ID: Mol00796)

• Name: Aminoglycoside N(3)-acetyltransferase (A3AC) ,Enterobacter cloacae
• Molecule Type: Protein
• Gene Name: aac
• Sequence:
  MTDPRKNGDLHEPATAPATPWSKSELVRQLRDLGVRSGDMVMPHVSLRAVGPLADGPQTL
  VDALIEAVGPTGNILAFVSWRDSPYEQTLGHDAPPAAIAQSWPAFDPDHAPAYPGFGAIN
  EFIRTYPGCRRTAHPDASMAAIGPDAAWLVAPHEMGAAYGPRSPIARFLAHAGKILSIGA
  GPDAVTALHYAEAVARIEGKRRVTYSMPLLREGKRVWVTTSDWDSNGILDEYAAPDGPDA
  VERIARDYLARTRVAQGPVGGAQSRLIDAADIVSFGIEWLEARHAAPAAAALKPKQRRD
• 3D-structure: PDB ID: 6BC7; Classification: Transferase/antibiotic; Method: X-ray diffraction; Resolution: 1.80 Å
• Function: Resistance to antibiotics containing the 2-deoxy-streptamine ring including gentamicin, kanamycin, tobramycin, neomycin and apramycin.
• Uniprot ID: Q47030_ENTCL

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Enterobacter
Species: Enterobacter cloacae

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Gentamicin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] [1], [2]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Gentamicin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli strain DH5a; 668369
• In Vitro Model: Enterobacter cloacae strain 88020217; 550
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: The resistance profile conferred by the AAC(3)-VIa enzyme,which encodes this novel 3-N-acetyltransferase,includes high-level resistance to gentamicin,sisomicin, and 6'-N-ethylnetilmicin and moderate levels of resistance to tobramycin and netilmicin.

References

• Ref 1: blaCMY-2-positive IncA/C plasmids from Escherichia coli and Salmonella enterica are a distinct component of a larger lineage of plasmids. Antimicrob Agents Chemother. 2010 Feb;54(2):590-6. doi: 10.1128/AAC.00055-09. Epub 2009 Nov 30.
• Ref 2: Analysis of the aac(3)-VIa gene encoding a novel 3-N-acetyltransferase. Antimicrob Agents Chemother. 1993 Oct;37(10):2074-9. doi: 10.1128/AAC.37.10.2074.