Molecule Information
General Information of the Molecule (ID: Mol00794)
Name |
Aminoglycoside adenylyltransferase (AAD5)
,Escherichia coli
|
||||
---|---|---|---|---|---|
Synonyms |
aadA5; Aminoglycoside adenylyltransferase
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aadA5
|
||||
Sequence |
MLDLLKVSSPPGDGGTWRPLELTVVARSEVVPWRYPARRELQFGEWLRHDILSGTFEPAV
LDHDLAILLTKARQHSLALLGPSAATFFEPVPKEHFSKALFDTIAQWNAESDWKGDERNV VLALARIWYSASTGLIAPKDVAAAWVSERLPAEHRPLICKARAAYLGSEDDDLAMRVEET AAFVRYAKATIERILRCAARAASASTPWRGHRSHRSAFKRRGSAVRSNMS Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Spectinomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain 9516014-1 | 562 | ||
Escherichia coli strain k-12 J62-2 | 83333 | |||
Salmonella enterica serotype Typhimurium DT104 no. 9720921 | 90371 | |||
Experiment for Molecule Alteration |
Sequencing with the QIAquick purification kit assay | |||
Experiment for Drug Resistance |
Sensititre system assay | |||
Mechanism Description | The aadA genes are the only characterized genes that encode both streptomycin and spectinomycin resistance, and many of these genes are found as gene cassettes. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain 9516014-1 | 562 | ||
Escherichia coli strain k-12 J62-2 | 83333 | |||
Salmonella enterica serotype Typhimurium DT104 no. 9720921 | 90371 | |||
Experiment for Molecule Alteration |
Sequencing with the QIAquick purification kit assay | |||
Experiment for Drug Resistance |
Sensititre system assay | |||
Mechanism Description | The aadA genes are the only characterized genes that encode both streptomycin and spectinomycin resistance, and many of these genes are found as gene cassettes. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.