Molecule Information

General Information of the Molecule (ID: Mol00794)

• Name: Aminoglycoside adenylyltransferase (AAD5) ,Escherichia coli
• Synonyms: aadA5; Aminoglycoside adenylyltransferase
• Molecule Type: Protein
• Gene Name: aadA5
• Sequence:
  MLDLLKVSSPPGDGGTWRPLELTVVARSEVVPWRYPARRELQFGEWLRHDILSGTFEPAV
  LDHDLAILLTKARQHSLALLGPSAATFFEPVPKEHFSKALFDTIAQWNAESDWKGDERNV
  VLALARIWYSASTGLIAPKDVAAAWVSERLPAEHRPLICKARAAYLGSEDDDLAMRVEET
  AAFVRYAKATIERILRCAARAASASTPWRGHRSHRSAFKRRGSAVRSNMS
• Uniprot ID: A0A896ZCC3_ECOLX

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Spectinomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Escherichia coli infection [1]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Spectinomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli strain 9516014-1; 562
• In Vitro Model: Escherichia coli strain k-12 J62-2; 83333
• In Vitro Model: Salmonella enterica serotype Typhimurium DT104 no. 9720921; 90371
• Experiment for Molecule Alteration: Sequencing with the QIAquick purification kit assay
• Experiment for Drug Resistance: Sensititre system assay
• Mechanism Description: The aadA genes are the only characterized genes that encode both streptomycin and spectinomycin resistance, and many of these genes are found as gene cassettes.

Streptomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Escherichia coli infection [1]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Streptomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli strain 9516014-1; 562
• In Vitro Model: Escherichia coli strain k-12 J62-2; 83333
• In Vitro Model: Salmonella enterica serotype Typhimurium DT104 no. 9720921; 90371
• Experiment for Molecule Alteration: Sequencing with the QIAquick purification kit assay
• Experiment for Drug Resistance: Sensititre system assay
• Mechanism Description: The aadA genes are the only characterized genes that encode both streptomycin and spectinomycin resistance, and many of these genes are found as gene cassettes.

References

• Ref 1: Novel streptomycin and spectinomycin resistance gene as a gene cassette within a class 1 integron isolated from Escherichia coli. Antimicrob Agents Chemother. 1999 Dec;43(12):3036-8. doi: 10.1128/AAC.43.12.3036.