General Information of the Molecule (ID: Mol00794)
Name
Aminoglycoside adenylyltransferase (AAD5) ,Escherichia coli
Synonyms
aadA5; Aminoglycoside adenylyltransferase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
aadA5
Sequence
MLDLLKVSSPPGDGGTWRPLELTVVARSEVVPWRYPARRELQFGEWLRHDILSGTFEPAV
LDHDLAILLTKARQHSLALLGPSAATFFEPVPKEHFSKALFDTIAQWNAESDWKGDERNV
VLALARIWYSASTGLIAPKDVAAAWVSERLPAEHRPLICKARAAYLGSEDDDLAMRVEET
AAFVRYAKATIERILRCAARAASASTPWRGHRSHRSAFKRRGSAVRSNMS
    Click to Show/Hide
Uniprot ID
A0A896ZCC3_ECOLX
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Spectinomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Spectinomycin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain 9516014-1 562
Escherichia coli strain k-12 J62-2 83333
Salmonella enterica serotype Typhimurium DT104 no. 9720921 90371
Experiment for
Molecule Alteration
Sequencing with the QIAquick purification kit assay
Experiment for
Drug Resistance
Sensititre system assay
Mechanism Description The aadA genes are the only characterized genes that encode both streptomycin and spectinomycin resistance, and many of these genes are found as gene cassettes.
Streptomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Streptomycin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain 9516014-1 562
Escherichia coli strain k-12 J62-2 83333
Salmonella enterica serotype Typhimurium DT104 no. 9720921 90371
Experiment for
Molecule Alteration
Sequencing with the QIAquick purification kit assay
Experiment for
Drug Resistance
Sensititre system assay
Mechanism Description The aadA genes are the only characterized genes that encode both streptomycin and spectinomycin resistance, and many of these genes are found as gene cassettes.
References
Ref 1 Novel streptomycin and spectinomycin resistance gene as a gene cassette within a class 1 integron isolated from Escherichia coli. Antimicrob Agents Chemother. 1999 Dec;43(12):3036-8. doi: 10.1128/AAC.43.12.3036.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.