General Information of the Molecule (ID: Mol00793)
Name
Aminoglycoside adenyltransferase 2''-Ia (ANT2I) ,Klebsiella pneumoniae
Synonyms
AAD(2''); Aminoglycoside adenyltransferase 2''-Ia; ANT(2'')-Ia; Gentamicin 2''-nucleotidyltransferase; Gentamicin resistance protein
    Click to Show/Hide
Molecule Type
Protein
Gene Name
aadB
Gene ID
67369350
Sequence
MDTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAI
VEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPV
RCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA
    Click to Show/Hide
Function
Mediates bacterial resistance to kanamycin, gentamicin, dibekacin, sisomicin and tobramycin by adenylating the 2''-hydroxyl group of these antibiotics.
    Click to Show/Hide
Uniprot ID
AADB1_KLEPN
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Klebsiella
Species: Klebsiella pneumoniae
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
Gentamicin B
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Gentamicin B
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AB5075 1116234
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Etest assay
Mechanism Description ANT(2")-Ia confers resistance by magnesium-dependent transfer of a nucleoside monophosphate (AMP) to the 2"-hydroxyl of aminoglycoside substrates containing a 2-deoxystreptamine core.
Gentamicin C
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Gentamicin C
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AB5075 1116234
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Etest assay
Mechanism Description ANT(2")-Ia confers resistance by magnesium-dependent transfer of a nucleoside monophosphate (AMP) to the 2"-hydroxyl of aminoglycoside substrates containing a 2-deoxystreptamine core.
Tobramycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Tobramycin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Acinetobacter baumannii AB5075 1116234
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Etest assay
Mechanism Description ANT(2")-Ia confers resistance by magnesium-dependent transfer of a nucleoside monophosphate (AMP) to the 2"-hydroxyl of aminoglycoside substrates containing a 2-deoxystreptamine core.
References
Ref 1 Structural and molecular basis for resistance to aminoglycoside antibiotics by the adenylyltransferase ANT(2")-Ia. mBio. 2015 Jan 6;6(1):e02180-14. doi: 10.1128/mBio.02180-14.
Ref 2 Nucleotide sequence of the AAD(2'') aminoglycoside adenylyltransferase determinant aadB. Evolutionary relationship of this region with those surrounding aadA in R538-1 and dhfrII in R388. Nucleic Acids Res. 1986 Nov 11;14(21):8625-35. doi: 10.1093/nar/14.21.8625.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.