Molecule Information

General Information of the Molecule (ID: Mol00793)

• Name: Aminoglycoside adenyltransferase 2''-Ia (ANT2I) ,Klebsiella pneumoniae
• Synonyms: AAD(2''); Aminoglycoside adenyltransferase 2''-Ia; ANT(2'')-Ia; Gentamicin 2''-nucleotidyltransferase; Gentamicin resistance protein
• Molecule Type: Protein
• Gene Name: aadB
• Gene ID: 67369350
• Sequence:
  MDTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAI
  VEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPV
  RCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA
• 3D-structure: PDB ID: 5KQJ; Classification: Transferase; Method: Solution nmr; Resolution: No Resolution Dat Å
• Function: Mediates bacterial resistance to kanamycin, gentamicin, dibekacin, sisomicin and tobramycin by adenylating the 2''-hydroxyl group of these antibiotics.
• Uniprot ID: AADB1_KLEPN

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Klebsiella
Species: Klebsiella pneumoniae

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 3 drug(s) in total

Gentamicin B

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] [1], [2]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Gentamicin B
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Acinetobacter baumannii AB5075; 1116234
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Etest assay
• Mechanism Description: ANT(2")-Ia confers resistance by magnesium-dependent transfer of a nucleoside monophosphate (AMP) to the 2"-hydroxyl of aminoglycoside substrates containing a 2-deoxystreptamine core.

Gentamicin C

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] [1], [2]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Gentamicin C
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Acinetobacter baumannii AB5075; 1116234
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Etest assay
• Mechanism Description: ANT(2")-Ia confers resistance by magnesium-dependent transfer of a nucleoside monophosphate (AMP) to the 2"-hydroxyl of aminoglycoside substrates containing a 2-deoxystreptamine core.

Tobramycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] [1], [2]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Tobramycin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Acinetobacter baumannii AB5075; 1116234
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Etest assay
• Mechanism Description: ANT(2")-Ia confers resistance by magnesium-dependent transfer of a nucleoside monophosphate (AMP) to the 2"-hydroxyl of aminoglycoside substrates containing a 2-deoxystreptamine core.

References

• Ref 1: Structural and molecular basis for resistance to aminoglycoside antibiotics by the adenylyltransferase ANT(2")-Ia. mBio. 2015 Jan 6;6(1):e02180-14. doi: 10.1128/mBio.02180-14.
• Ref 2: Nucleotide sequence of the AAD(2'') aminoglycoside adenylyltransferase determinant aadB. Evolutionary relationship of this region with those surrounding aadA in R538-1 and dhfrII in R388. Nucleic Acids Res. 1986 Nov 11;14(21):8625-35. doi: 10.1093/nar/14.21.8625.