Molecule Information
General Information of the Molecule (ID: Mol00791)
| Name |
Aminoglycoside acetyltransferase (AAC)
,Escherichia coli
|
||||
|---|---|---|---|---|---|
| Synonyms |
aac(6')-Im; Aminoglycoside acetyltransferase
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
aac(6')-Im
|
||||
| Sequence |
MLEKKRVSFRPMNEDDLVLMLKWLTDDRVLEFYDGRDKKHTQKTIREHYTEQWADEIYRV
IIEYDTIPIGYAQIYRIQGELFDEYNYHETEEKIYAMDQFIGEPEYWNMGIGAEYCRVVC QYLRTEMDADAVILDPRKNNLRAVRAYQKAGFKIIKELPEHELHEGKKEDCVLMEWRV Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Amikacin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Escherichia coli SCH92111602 | 562 | |||
| Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
| Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
| Mechanism Description | Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Dibekacin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Escherichia coli SCH92111602 | 562 | |||
| Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
| Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
| Mechanism Description | Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Dibekacin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Escherichia coli SCH92111602 | 562 | |||
| Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
| Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
| Mechanism Description | Plasmid DNA isolated from this strain was introduced into Escherichia coli DH5alpha by transformation, and colonies were selected on Luria-Bertani agar plates containing 10 ug of tobramycin per ml. Analysis of restriction digests on agarose gels of DNA from a tobramycin-resistant transformant confirmed the presence of the same 50-kb plasmid that was isolated from Escherichia coli SCH92111602. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Escherichia coli SCH92111602 | 562 | |||
| Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
| Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
| Mechanism Description | Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Escherichia coli SCH92111602 | 562 | |||
| Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
| Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
| Mechanism Description | Plasmid DNA isolated from this strain was introduced into Escherichia coli DH5alpha by transformation, and colonies were selected on Luria-Bertani agar plates containing 10 ug of tobramycin per ml. Analysis of restriction digests on agarose gels of DNA from a tobramycin-resistant transformant confirmed the presence of the same 50-kb plasmid that was isolated from Escherichia coli SCH92111602. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Netilmicin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Escherichia coli SCH92111602 | 562 | |||
| Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
| Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
| Mechanism Description | Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Tobramycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Escherichia coli SCH92111602 | 562 | |||
| Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
| Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
| Mechanism Description | Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Tobramycin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Escherichia coli SCH92111602 | 562 | |||
| Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
| Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
| Mechanism Description | Plasmid DNA isolated from this strain was introduced into Escherichia coli DH5alpha by transformation, and colonies were selected on Luria-Bertani agar plates containing 10 ug of tobramycin per ml. Analysis of restriction digests on agarose gels of DNA from a tobramycin-resistant transformant confirmed the presence of the same 50-kb plasmid that was isolated from Escherichia coli SCH92111602. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
