Molecule Information
General Information of the Molecule (ID: Mol00791)
Name |
Aminoglycoside acetyltransferase (AAC)
,Escherichia coli
|
||||
---|---|---|---|---|---|
Synonyms |
aac(6')-Im; Aminoglycoside acetyltransferase
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aac(6')-Im
|
||||
Sequence |
MLEKKRVSFRPMNEDDLVLMLKWLTDDRVLEFYDGRDKKHTQKTIREHYTEQWADEIYRV
IIEYDTIPIGYAQIYRIQGELFDEYNYHETEEKIYAMDQFIGEPEYWNMGIGAEYCRVVC QYLRTEMDADAVILDPRKNNLRAVRAYQKAGFKIIKELPEHELHEGKKEDCVLMEWRV Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Amikacin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Escherichia coli SCH92111602 | 562 | |||
Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
Mechanism Description | Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Dibekacin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Escherichia coli SCH92111602 | 562 | |||
Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
Mechanism Description | Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid. | |||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Dibekacin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Escherichia coli SCH92111602 | 562 | |||
Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
Mechanism Description | Plasmid DNA isolated from this strain was introduced into Escherichia coli DH5alpha by transformation, and colonies were selected on Luria-Bertani agar plates containing 10 ug of tobramycin per ml. Analysis of restriction digests on agarose gels of DNA from a tobramycin-resistant transformant confirmed the presence of the same 50-kb plasmid that was isolated from Escherichia coli SCH92111602. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Escherichia coli SCH92111602 | 562 | |||
Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
Mechanism Description | Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid. | |||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Escherichia coli SCH92111602 | 562 | |||
Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
Mechanism Description | Plasmid DNA isolated from this strain was introduced into Escherichia coli DH5alpha by transformation, and colonies were selected on Luria-Bertani agar plates containing 10 ug of tobramycin per ml. Analysis of restriction digests on agarose gels of DNA from a tobramycin-resistant transformant confirmed the presence of the same 50-kb plasmid that was isolated from Escherichia coli SCH92111602. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Netilmicin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Escherichia coli SCH92111602 | 562 | |||
Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
Mechanism Description | Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Tobramycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Escherichia coli SCH92111602 | 562 | |||
Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
Mechanism Description | Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid. | |||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Tobramycin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Escherichia coli SCH92111602 | 562 | |||
Experiment for Molecule Alteration |
Dot blot hybridizations assay | |||
Experiment for Drug Resistance |
Standard broth microdilution method assay | |||
Mechanism Description | Plasmid DNA isolated from this strain was introduced into Escherichia coli DH5alpha by transformation, and colonies were selected on Luria-Bertani agar plates containing 10 ug of tobramycin per ml. Analysis of restriction digests on agarose gels of DNA from a tobramycin-resistant transformant confirmed the presence of the same 50-kb plasmid that was isolated from Escherichia coli SCH92111602. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.