General Information of the Molecule (ID: Mol00791)
Name
Aminoglycoside acetyltransferase (AAC) ,Escherichia coli
Synonyms
aac(6')-Im; Aminoglycoside acetyltransferase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
aac(6')-Im
Sequence
MLEKKRVSFRPMNEDDLVLMLKWLTDDRVLEFYDGRDKKHTQKTIREHYTEQWADEIYRV
IIEYDTIPIGYAQIYRIQGELFDEYNYHETEEKIYAMDQFIGEPEYWNMGIGAEYCRVVC
QYLRTEMDADAVILDPRKNNLRAVRAYQKAGFKIIKELPEHELHEGKKEDCVLMEWRV
    Click to Show/Hide
3D-structure
PDB ID
6BFF
Classification
Transferase
Method
X-ray diffraction
Resolution
1.70  Å
Uniprot ID
Q93ET8_ECOLX
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Click to Show/Hide the Full List of Drugs
Amikacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Amikacin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Escherichia coli SCH92111602 562
Experiment for
Molecule Alteration
Dot blot hybridizations assay
Experiment for
Drug Resistance
Standard broth microdilution method assay
Mechanism Description Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid.
Dibekacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Dibekacin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Escherichia coli SCH92111602 562
Experiment for
Molecule Alteration
Dot blot hybridizations assay
Experiment for
Drug Resistance
Standard broth microdilution method assay
Mechanism Description Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid.
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Dibekacin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Escherichia coli SCH92111602 562
Experiment for
Molecule Alteration
Dot blot hybridizations assay
Experiment for
Drug Resistance
Standard broth microdilution method assay
Mechanism Description Plasmid DNA isolated from this strain was introduced into Escherichia coli DH5alpha by transformation, and colonies were selected on Luria-Bertani agar plates containing 10 ug of tobramycin per ml. Analysis of restriction digests on agarose gels of DNA from a tobramycin-resistant transformant confirmed the presence of the same 50-kb plasmid that was isolated from Escherichia coli SCH92111602.
Kanamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Kanamycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Escherichia coli SCH92111602 562
Experiment for
Molecule Alteration
Dot blot hybridizations assay
Experiment for
Drug Resistance
Standard broth microdilution method assay
Mechanism Description Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid.
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Kanamycin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Escherichia coli SCH92111602 562
Experiment for
Molecule Alteration
Dot blot hybridizations assay
Experiment for
Drug Resistance
Standard broth microdilution method assay
Mechanism Description Plasmid DNA isolated from this strain was introduced into Escherichia coli DH5alpha by transformation, and colonies were selected on Luria-Bertani agar plates containing 10 ug of tobramycin per ml. Analysis of restriction digests on agarose gels of DNA from a tobramycin-resistant transformant confirmed the presence of the same 50-kb plasmid that was isolated from Escherichia coli SCH92111602.
Netilmicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Netilmicin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Escherichia coli SCH92111602 562
Experiment for
Molecule Alteration
Dot blot hybridizations assay
Experiment for
Drug Resistance
Standard broth microdilution method assay
Mechanism Description Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid.
Tobramycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Tobramycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Escherichia coli SCH92111602 562
Experiment for
Molecule Alteration
Dot blot hybridizations assay
Experiment for
Drug Resistance
Standard broth microdilution method assay
Mechanism Description Escherichia coli SCH92111602 expresses an aminoglycoside resistance profile similar to that conferred by the aac(6')-Ie-aph(2")-Ia gene found in gram-positive cocci and was found to contain the aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im (only 44 nucleotides apart). SCH92111602 is an Escherichia coli clinical isolate resistant to a number of aminoglycoside antibiotics, including gentamicin, tobramycin, and amikacin, and contains an approximately 50-kb plasmid.
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Tobramycin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Escherichia coli SCH92111602 562
Experiment for
Molecule Alteration
Dot blot hybridizations assay
Experiment for
Drug Resistance
Standard broth microdilution method assay
Mechanism Description Plasmid DNA isolated from this strain was introduced into Escherichia coli DH5alpha by transformation, and colonies were selected on Luria-Bertani agar plates containing 10 ug of tobramycin per ml. Analysis of restriction digests on agarose gels of DNA from a tobramycin-resistant transformant confirmed the presence of the same 50-kb plasmid that was isolated from Escherichia coli SCH92111602.
References
Ref 1 Aminoglycoside resistance genes aph(2")-Ib and aac(6')-Im detected together in strains of both Escherichia coli and Enterococcus faecium. Antimicrob Agents Chemother. 2001 Oct;45(10):2691-4. doi: 10.1128/AAC.45.10.2691-2694.2001.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.