Molecule Information
General Information of the Molecule (ID: Mol00790)
Name |
Aminoglycoside 6-adenylyltransferase (A6AD)
,Bacillus subtilis
|
||||
---|---|---|---|---|---|
Synonyms |
6-O-adenyl-transferase; AAD(6); ANT(6); Aminoglycoside inactivating enzyme; Sm inactivating enzyme; Streptomycin 6-adenylyltransferase; BSU26790; HIR78_15755
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aadK
|
||||
Gene ID | |||||
Sequence |
MRSEQEMMDIFLDFALNDERIRLVTLEGSRTNRNIPPDNFQDYDISYFVTDVESFKENDQ
WLEIFGKRIMMQKPEDMELFPPELGNWFSYIILFEDGNKLDLTLIPIREAEDYFANNDGL VKVLLDKDSFINYKVTPNDRQYWIKRPTAREFDDCCNEFWMVSTYVVKGLARNEILFAID HLNEIVRPNLLRMMAWHIASQKGYSFSMGKNYKFMKRYLSNKEWEELMSTYSVNGYQEMW KSLFTCYALFRKYSKAVSEGLAYKYPDYDEGITKYTEGIYCSVK Click to Show/Hide
|
||||
Function |
Mediates bacterial resistance to streptomycin. Adenylates streptomycin on the O-6 residue. Adenylates streptidine on the O-6 residue. Does not act on spectinomycin, neomycin-B or kanamycin (Ref.5984036). Specific for ATP and GTP nucleotides incorporating a purine ring. No reaction with CTP or UTP.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Bacillus subtilis strain 168 | 1423 | ||
Bacillus subtilis strain 169 | 1423 | |||
Bacillus subtilis strain 170 | 1423 | |||
Bacillus subtilis strain 171 | 1423 | |||
Bacillus subtilis strain 172 | 1423 | |||
Bacillus subtilis strain 173 | 1423 | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | B. subtilis 168 produce s a chromosomally encoded aminoglycoside 6-adenylyltransferase, AAD(6),which inactivates S M by adenylation at the C-6 position of streptomycin. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.