General Information of the Molecule (ID: Mol00787)
Name
Aminoglycoside 3'-phosphotransferase (A3AP) ,Streptococcus faecalis
Synonyms
APH(3')III; Kanamycin kinase; type III; Neomycin-kanamycin phosphotransferase type III
    Click to Show/Hide
Molecule Type
Protein
Gene Name
aphA
Gene ID
63968956
Sequence
MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKMTDSRYKGTTYDVERE
KDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYEDEQSPEKIIELYAECIR
LFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDTPFKDPRELYDFLKTEKP
EEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIAFCVRSIREDIGEEQYVEL
FFDLLGIKPDWEKIKYYILLDELF
    Click to Show/Hide
Function
Resistance to kanamycin and structurally-related aminoglycosides, including amikacin.
    Click to Show/Hide
Uniprot ID
KKA3_ENTFL
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus faecalis
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Amikacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Streptococcus faecalis infection [1]
Resistant Disease Streptococcus faecalis infection [ICD-11: 1A00-1C4Z]
Resistant Drug Amikacin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain JM 10 562
Escherichia coli strain k802 562
Streptococcus faecnlis strain JHZ-15 1351
Experiment for
Molecule Alteration
Chemical sequencing method assay
Experiment for
Drug Resistance
Disc sensitivity tests assay
Mechanism Description Strain BM2182 was examined for aminoglyco- side-modifying activities. That kanamycin B was modified and tobramycin (3'-deoxykanamycin B) was not, indicates that the 3'-hydroxyl group is the site of phosphorylation. That butirosin, lividomycin A, and amikacin were phosphorylated indicates that the enzyme is APH-III.
Kanamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Streptococcus faecalis infection [1]
Resistant Disease Streptococcus faecalis infection [ICD-11: 1A00-1C4Z]
Resistant Drug Kanamycin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain JM 10 562
Escherichia coli strain k802 562
Streptococcus faecnlis strain JHZ-15 1351
Experiment for
Molecule Alteration
Chemical sequencing method assay
Experiment for
Drug Resistance
Disc sensitivity tests assay
Mechanism Description Streptococcus jaecalis strain JH2- 15 is resistant to high levels of kanamycin (MIC > 1 mg/ml) and structurally related antibiotics. This broad-resistance phenotype is due to the presence of an APH-III. The gene encoding the enzyme in JH2-15 is borne by a 72.6-kb R plasmid, pJH1, capable of self-transfer to streptococcal cells. In pathogenic bacteria, 3'-aminoglycoside phosphotransferases exist under three (types I, II, and III) isozymic forms which differ, in particular, in their substrate ranges. APH-III enzyme appears to be specific for the Gram-positive cocci, whereas 3'-phosphotransferases of types I and II are found exclusively in Gram-negative bacteria.
Investigative Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Butirosina
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Streptococcus faecalis infection [1]
Resistant Disease Streptococcus faecalis infection [ICD-11: 1A00-1C4Z]
Resistant Drug Butirosina
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain JM 10 562
Escherichia coli strain k802 562
Streptococcus faecnlis strain JHZ-15 1351
Experiment for
Molecule Alteration
Chemical sequencing method assay
Experiment for
Drug Resistance
Disc sensitivity tests assay
Mechanism Description Strain BM2182 was examined for aminoglyco- side-modifying activities. That kanamycin B was modified and tobramycin (3'-deoxykanamycin B) was not, indicates that the 3'-hydroxyl group is the site of phosphorylation. That butirosin, lividomycin A, and amikacin were phosphorylated indicates that the enzyme is APH-III.
Lividomycin A
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Streptococcus faecalis infection [1]
Resistant Disease Streptococcus faecalis infection [ICD-11: 1A00-1C4Z]
Resistant Drug Lividomycin A
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain JM 10 562
Escherichia coli strain k802 562
Streptococcus faecnlis strain JHZ-15 1351
Experiment for
Molecule Alteration
Chemical sequencing method assay
Experiment for
Drug Resistance
Disc sensitivity tests assay
Mechanism Description Strain BM2182 was examined for aminoglyco- side-modifying activities. That kanamycin B was modified and tobramycin (3'-deoxykanamycin B) was not, indicates that the 3'-hydroxyl group is the site of phosphorylation. That butirosin, lividomycin A, and amikacin were phosphorylated indicates that the enzyme is APH-III.
References
Ref 1 Nucleotide sequence of the Streptococcus faecalis plasmid gene encoding the 3'5"-aminoglycoside phosphotransferase type III. Gene. 1983 Sep;23(3):331-41. doi: 10.1016/0378-1119(83)90022-7.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.