Molecule Information
General Information of the Molecule (ID: Mol00786)
Name |
Aminoglycoside 3'-phosphotransferase (A3AP)
,Bacillus circulans
|
||||
---|---|---|---|---|---|
Synonyms |
APH(3')IV; Butirosin resistance protein A; Kanamycin kinase; type IV; Neomycin-kanamycin phosphotransferase type IV; aph; butA
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aphA4
|
||||
Sequence |
MNESTRNWPEELLELLGQTELTVNKIGYSGDHVYHVKEYRGTPAFLKIAPSVWWRTLRPE
IEALAWLDGKLPVPKILYTAEHGGMDYLLMEALGGKDGSHETIQAKRKLFVKLYAEGLRS VHGLDIRECPLSNGLEKKLRDAKRIVDESLVDPADIKEEYDCTPEELYGLLLESKPVTED LVFAHGDYCAPNLIIDGEKLSGFIDLGRAGVADRYQDISLAIRSLRHDYGDDRYKALFLE LYGLDGLDEDKVRYYIRLDEFF Click to Show/Hide
|
||||
Function |
Resistance to butirosin and structurally-related aminoglycosides, including kanamycin and amikacin.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Ampicillin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli HB101 | 634468 | ||
Escherichia coli strain JM103 | 83333 | |||
Bacillus circulans strain | 1397 | |||
Streptomyces lividans strain 66 | 1200984 | |||
Streptomyces lividans strain M180 | 1916 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Semi-quantitative phosphocellulose-paper binding assay method assay | |||
Mechanism Description | The previous demonstration that the APH gene of B. circulans could be expressed in E.coli. These contained a 5.5kb Hind3-digest insert (pCH4) or a 2.7kb Sal1-digest insert (pCH5) at the corresponding site in pBR322. Both these derivatives expressed ampicillin and ribostamycin resistance in E.coli. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Infection by Bacillus circulans | [1] | |||
Resistant Disease | Infection by Bacillus circulans [ICD-11: 1C4Y.12] | |||
Resistant Drug | Ribostamycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli HB101 | 634468 | ||
Escherichia coli strain JM103 | 83333 | |||
Bacillus circulans strain | 1397 | |||
Streptomyces lividans strain 66 | 1200984 | |||
Streptomyces lividans strain M180 | 1916 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Semi-quantitative phosphocellulose-paper binding assay method assay | |||
Mechanism Description | We have elucidated the full nucleotide sequence of the aminoglycoside phosphotransferase (APH) gene from Bacillus circulans, which produces the aminoglycoside antibiotic butirosin. | |||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Ribostamycin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli HB101 | 634468 | ||
Escherichia coli strain JM103 | 83333 | |||
Bacillus circulans strain | 1397 | |||
Streptomyces lividans strain 66 | 1200984 | |||
Streptomyces lividans strain M180 | 1916 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Semi-quantitative phosphocellulose-paper binding assay method assay | |||
Mechanism Description | The previous demonstration that the APH gene of B. circulans could be expressed in E.coli. These contained a 5.5kb Hind3-digest insert (pCH4) or a 2.7kb Sal1-digest insert (pCH5) at the corresponding site in pBR322. Both these derivatives expressed ampicillin and ribostamycin resistance in E.coli. | |||
Disease Class: Streptomyces lividans infection | [1] | |||
Resistant Disease | Streptomyces lividans infection [ICD-11: 1C43.8] | |||
Resistant Drug | Ribostamycin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli HB101 | 634468 | ||
Escherichia coli strain JM103 | 83333 | |||
Bacillus circulans strain | 1397 | |||
Streptomyces lividans strain 66 | 1200984 | |||
Streptomyces lividans strain M180 | 1916 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Semi-quantitative phosphocellulose-paper binding assay method assay | |||
Mechanism Description | In attempts to express the B. circulans APH gene in Strep. lividans 66,the 2.7kb Sal1-digest insert of pCH5 was transferred to the Streptomyces vector SLP1.2 by ligating a mixture of a Sal1-digest of pCH5 (1ug) and a partial digest of SLP1.2 (0.5ug) cut at one or two sites of its three Sal1 sites. After incubation, 51 patches of drug-resistant growth were seen. This demonstrated that the ribostamycin-resistance is linked to the plasmid. |
Investigative Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Infection by Bacillus circulans | [1] | |||
Resistant Disease | Infection by Bacillus circulans [ICD-11: 1C4Y.12] | |||
Resistant Drug | Butirosina | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli HB101 | 634468 | ||
Escherichia coli strain JM103 | 83333 | |||
Bacillus circulans strain | 1397 | |||
Streptomyces lividans strain 66 | 1200984 | |||
Streptomyces lividans strain M180 | 1916 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Semi-quantitative phosphocellulose-paper binding assay method assay | |||
Mechanism Description | We have elucidated the full nucleotide sequence of the aminoglycoside phosphotransferase (APH) gene from Bacillus circulans, which produces the aminoglycoside antibiotic butirosin. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.