Molecule Information

General Information of the Molecule (ID: Mol00786)
Name
Aminoglycoside 3'-phosphotransferase (A3AP) ,Bacillus circulans
Synonyms
APH(3')IV; Butirosin resistance protein A; Kanamycin kinase; type IV; Neomycin-kanamycin phosphotransferase type IV; aph; butA
    Click to Show/Hide
Molecule Type
Protein
Gene Name
aphA4
Sequence
MNESTRNWPEELLELLGQTELTVNKIGYSGDHVYHVKEYRGTPAFLKIAPSVWWRTLRPE
IEALAWLDGKLPVPKILYTAEHGGMDYLLMEALGGKDGSHETIQAKRKLFVKLYAEGLRS
VHGLDIRECPLSNGLEKKLRDAKRIVDESLVDPADIKEEYDCTPEELYGLLLESKPVTED
LVFAHGDYCAPNLIIDGEKLSGFIDLGRAGVADRYQDISLAIRSLRHDYGDDRYKALFLE
LYGLDGLDEDKVRYYIRLDEFF
    Click to Show/Hide
Function
Resistance to butirosin and structurally-related aminoglycosides, including kanamycin and amikacin.
    Click to Show/Hide
Uniprot ID
KKA4_NIACI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Bacillaceae
Genus: Niallia
Species: Niallia circulans
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ampicillin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
 Disease Info 
Resistant Drug Ampicillin
 Drug Info 
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Escherichia coli strain JM103 83333
Bacillus circulans strain 1397
Streptomyces lividans strain 66 1200984
Streptomyces lividans strain M180 1916
Experiment for
Molecule Alteration		 DNA sequencing assay
Experiment for
Drug Resistance		 Semi-quantitative phosphocellulose-paper binding assay method assay
Mechanism Description The previous demonstration that the APH gene of B. circulans could be expressed in E.coli. These contained a 5.5kb Hind3-digest insert (pCH4) or a 2.7kb Sal1-digest insert (pCH5) at the corresponding site in pBR322. Both these derivatives expressed ampicillin and ribostamycin resistance in E.coli.
Ribostamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Infection by Bacillus circulans [ICD-11: 1C4Y.12] [1]
Resistant Disease Infection by Bacillus circulans [ICD-11: 1C4Y.12]
 Disease Info 
Resistant Drug Ribostamycin
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Escherichia coli strain JM103 83333
Bacillus circulans strain 1397
Streptomyces lividans strain 66 1200984
Streptomyces lividans strain M180 1916
Experiment for
Molecule Alteration		 DNA sequencing assay
Experiment for
Drug Resistance		 Semi-quantitative phosphocellulose-paper binding assay method assay
Mechanism Description We have elucidated the full nucleotide sequence of the aminoglycoside phosphotransferase (APH) gene from Bacillus circulans, which produces the aminoglycoside antibiotic butirosin.
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
 Disease Info 
Resistant Drug Ribostamycin
 Drug Info 
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Escherichia coli strain JM103 83333
Bacillus circulans strain 1397
Streptomyces lividans strain 66 1200984
Streptomyces lividans strain M180 1916
Experiment for
Molecule Alteration		 DNA sequencing assay
Experiment for
Drug Resistance		 Semi-quantitative phosphocellulose-paper binding assay method assay
Mechanism Description The previous demonstration that the APH gene of B. circulans could be expressed in E.coli. These contained a 5.5kb Hind3-digest insert (pCH4) or a 2.7kb Sal1-digest insert (pCH5) at the corresponding site in pBR322. Both these derivatives expressed ampicillin and ribostamycin resistance in E.coli.
Disease Class: Streptomyces lividans infection [ICD-11: 1C43.8] [1]
Resistant Disease Streptomyces lividans infection [ICD-11: 1C43.8]
 Disease Info 
Resistant Drug Ribostamycin
 Drug Info 
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Escherichia coli strain JM103 83333
Bacillus circulans strain 1397
Streptomyces lividans strain 66 1200984
Streptomyces lividans strain M180 1916
Experiment for
Molecule Alteration		 DNA sequencing assay
Experiment for
Drug Resistance		 Semi-quantitative phosphocellulose-paper binding assay method assay
Mechanism Description In attempts to express the B. circulans APH gene in Strep. lividans 66,the 2.7kb Sal1-digest insert of pCH5 was transferred to the Streptomyces vector SLP1.2 by ligating a mixture of a Sal1-digest of pCH5 (1ug) and a partial digest of SLP1.2 (0.5ug) cut at one or two sites of its three Sal1 sites. After incubation, 51 patches of drug-resistant growth were seen. This demonstrated that the ribostamycin-resistance is linked to the plasmid.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Butirosina
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Infection by Bacillus circulans [ICD-11: 1C4Y.12] [1]
Resistant Disease Infection by Bacillus circulans [ICD-11: 1C4Y.12]
 Disease Info 
Resistant Drug Butirosina
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Escherichia coli strain JM103 83333
Bacillus circulans strain 1397
Streptomyces lividans strain 66 1200984
Streptomyces lividans strain M180 1916
Experiment for
Molecule Alteration		 DNA sequencing assay
Experiment for
Drug Resistance		 Semi-quantitative phosphocellulose-paper binding assay method assay
Mechanism Description We have elucidated the full nucleotide sequence of the aminoglycoside phosphotransferase (APH) gene from Bacillus circulans, which produces the aminoglycoside antibiotic butirosin.
References
Ref 1 Sequence and interspecies transfer of an aminoglycoside phosphotransferase gene (APH) of Bacillus circulans. Self-defence mechanism in antibiotic-producing organisms. Biochem J. 1986 Jan 15;233(2):383-93. doi: 10.1042/bj2330383.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.