Molecule Information
General Information of the Molecule (ID: Mol00784)
| Name |
Aminoglycoside 3'-phosphotransferase (A3AP)
,Campylobacter jejuni
|
||||
|---|---|---|---|---|---|
| Synonyms |
APH(3')VII; Kanamycin kinase; type VII; Neomycin-kanamycin phosphotransferase type VII
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
aphA-7
|
||||
| Sequence |
MKYIDEIQILGKCSEGMSPAEVYKCQLKNTVCYLKKIDDIFSKTTYSVKREAEMMMWLSD
KLKVPDVIEYGVREHSEYLIMSELRGKHIDCFIDHPIKYIECLVNALHQLQAIDIRNCPF SSKIDVRLKELKYLLDNRIADIDVSNWEDTTEFDDPMTLYQWLCENQPQEELCLSHGDMS ANFFVSHDGIYFYDLARCGVADKWLDIAFCVREIREYYPDSDYEKFFFNMLGLEPDYKKI NYYILLDEMF Click to Show/Hide
|
||||
| Function |
Resistance to kanamycin and structurally-related aminoglycosides, including amikacin.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Campylobacter fetus infection [ICD-11: 1C40.0] | [1] | |||
| Resistant Disease | Campylobacter fetus infection [ICD-11: 1C40.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Campylobacter jejuni | 197 | ||
| Escherichia coli strain JC2926 C600 | 562 | |||
| Experiment for Molecule Alteration |
Dideoxy method assay | |||
| Experiment for Drug Resistance |
Disk diffusion method assay | |||
| Mechanism Description | A novel kanamycin phosphotransferase gene, aphA-7, was cloned from a 14-kb plasmid obtained from a strain of Campylobacter jejuni and the nucleotide sequence of the gene was determined. The presumed open reading frame of the aphA-7 structural gene was 753 bp in length and encoded a protein of 251 amino acids with a calculated weight of 29,691 Da. | |||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Campylobacter jejuni | 197 | ||
| Escherichia coli strain JC2926 C600 | 562 | |||
| Experiment for Molecule Alteration |
Dideoxy method assay | |||
| Experiment for Drug Resistance |
Disk diffusion method assay | |||
| Mechanism Description | A novel kanamycin phosphotransferase gene, aphA-7, was cloned from a 14-kb plasmid obtained from a strain of Campylobacter jejuni and the nucleotide sequence of the gene was determined. The presumed open reading frame of the aphA-7 structural gene was 753 bp in length and encoded a protein of 251 amino acids with a calculated weight of 29,691 Da. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
