Molecule Information
General Information of the Molecule (ID: Mol00784)
Name |
Aminoglycoside 3'-phosphotransferase (A3AP)
,Campylobacter jejuni
|
||||
---|---|---|---|---|---|
Synonyms |
APH(3')VII; Kanamycin kinase; type VII; Neomycin-kanamycin phosphotransferase type VII
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aphA-7
|
||||
Sequence |
MKYIDEIQILGKCSEGMSPAEVYKCQLKNTVCYLKKIDDIFSKTTYSVKREAEMMMWLSD
KLKVPDVIEYGVREHSEYLIMSELRGKHIDCFIDHPIKYIECLVNALHQLQAIDIRNCPF SSKIDVRLKELKYLLDNRIADIDVSNWEDTTEFDDPMTLYQWLCENQPQEELCLSHGDMS ANFFVSHDGIYFYDLARCGVADKWLDIAFCVREIREYYPDSDYEKFFFNMLGLEPDYKKI NYYILLDEMF Click to Show/Hide
|
||||
Function |
Resistance to kanamycin and structurally-related aminoglycosides, including amikacin.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Campylobacter fetus infection | [1] | |||
Resistant Disease | Campylobacter fetus infection [ICD-11: 1C40.0] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Campylobacter jejuni | 197 | ||
Escherichia coli strain JC2926 C600 | 562 | |||
Experiment for Molecule Alteration |
Dideoxy method assay | |||
Experiment for Drug Resistance |
Disk diffusion method assay | |||
Mechanism Description | A novel kanamycin phosphotransferase gene, aphA-7, was cloned from a 14-kb plasmid obtained from a strain of Campylobacter jejuni and the nucleotide sequence of the gene was determined. The presumed open reading frame of the aphA-7 structural gene was 753 bp in length and encoded a protein of 251 amino acids with a calculated weight of 29,691 Da. | |||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Campylobacter jejuni | 197 | ||
Escherichia coli strain JC2926 C600 | 562 | |||
Experiment for Molecule Alteration |
Dideoxy method assay | |||
Experiment for Drug Resistance |
Disk diffusion method assay | |||
Mechanism Description | A novel kanamycin phosphotransferase gene, aphA-7, was cloned from a 14-kb plasmid obtained from a strain of Campylobacter jejuni and the nucleotide sequence of the gene was determined. The presumed open reading frame of the aphA-7 structural gene was 753 bp in length and encoded a protein of 251 amino acids with a calculated weight of 29,691 Da. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.