Molecule Information
General Information of the Molecule (ID: Mol00779)
Name |
Aminoglycoside 2'-N-acetyltransferase (A2NA)
,Providencia stuartii
|
||||
---|---|---|---|---|---|
Synonyms |
AAC(2')-Ia
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aac
|
||||
Sequence |
MGIEYRSLHTSQLTLSEKEALYDLLIEGFEGDFSHDDFAHTLGGMHVMAFDQQKLVGHVA
IIQRHMALDNTPISVGYVEAMVVEQSYRRQGIGRQLMLQTNKIIASCYQLGLLSASDDGQ KLYHSVGWQIWKGKLFELKQGSYIRSIEEEGGVMGWKADGEVDFTASLYCDFRGGDQW Click to Show/Hide
|
||||
Function |
Catalyzes the coenzyme A-dependent acetylation of the 2' hydroxyl or amino group of a broad spectrum of aminoglycosides. It confers resistance to aminoglycosides.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Amikacin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain DH5a | 668369 | ||
Escherichia coli strain XLI-Blue | 562 | |||
Providencia stuartii strain PR50 | 588 | |||
Providencia stuartii strain SCH75082831A | 588 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Microdilution plates assay | |||
Mechanism Description | E.coli DH5alpha/pR 1000 demonstrated an AAC(2')-Ia resistance profile,with gentamicin, tobramycin, netilmicin, and 6'-Nethylnetilmicin MICs increased over those seen with E.coli DH5alpha. In addition, E.coli DH5alpha/pR 1000 did not show an elevated 2'-N-ethylnetilmicin MIC (MIC was 0.25ug/ml). Therefore, pR1000 encoded an enzyme capable of acetylating 6'-N-ethylnetilmicin but not 2'-N-ethylnetilmicin, suggesting 2'-N-acetyltransferase activity. DH5alpha/pSCH4500, which contains a subcloned 1.3-kb fragment, also demonstrated an AAC(2')-Ia resistance profile. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Gentamicin B | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain DH5a | 668369 | ||
Escherichia coli strain XLI-Blue | 562 | |||
Providencia stuartii strain PR50 | 588 | |||
Providencia stuartii strain SCH75082831A | 588 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Microdilution plates assay | |||
Mechanism Description | E.coli DH5alpha/pR 1000 demonstrated an AAC(2')-Ia resistance profile,with gentamicin, tobramycin, netilmicin, and 6'-Nethylnetilmicin MICs increased over those seen with E.coli DH5alpha. In addition, E.coli DH5alpha/pR 1000 did not show an elevated 2'-N-ethylnetilmicin MIC (MIC was 0.25ug/ml). Therefore, pR1000 encoded an enzyme capable of acetylating 6'-N-ethylnetilmicin but not 2'-N-ethylnetilmicin, suggesting 2'-N-acetyltransferase activity. DH5alpha/pSCH4500, which contains a subcloned 1.3-kb fragment, also demonstrated an AAC(2')-Ia resistance profile. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Gentamicin C | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain DH5a | 668369 | ||
Escherichia coli strain XLI-Blue | 562 | |||
Providencia stuartii strain PR50 | 588 | |||
Providencia stuartii strain SCH75082831A | 588 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Microdilution plates assay | |||
Mechanism Description | E.coli DH5alpha/pR 1000 demonstrated an AAC(2')-Ia resistance profile,with gentamicin, tobramycin, netilmicin, and 6'-Nethylnetilmicin MICs increased over those seen with E.coli DH5alpha. In addition, E.coli DH5alpha/pR 1000 did not show an elevated 2'-N-ethylnetilmicin MIC (MIC was 0.25ug/ml). Therefore, pR1000 encoded an enzyme capable of acetylating 6'-N-ethylnetilmicin but not 2'-N-ethylnetilmicin, suggesting 2'-N-acetyltransferase activity. DH5alpha/pSCH4500, which contains a subcloned 1.3-kb fragment, also demonstrated an AAC(2')-Ia resistance profile. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Isepamicin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain DH5a | 668369 | ||
Escherichia coli strain XLI-Blue | 562 | |||
Providencia stuartii strain PR50 | 588 | |||
Providencia stuartii strain SCH75082831A | 588 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Microdilution plates assay | |||
Mechanism Description | E.coli DH5alpha/pR 1000 demonstrated an AAC(2')-Ia resistance profile,with gentamicin, tobramycin, netilmicin, and 6'-Nethylnetilmicin MICs increased over those seen with E.coli DH5alpha. In addition, E.coli DH5alpha/pR 1000 did not show an elevated 2'-N-ethylnetilmicin MIC (MIC was 0.25ug/ml). Therefore, pR1000 encoded an enzyme capable of acetylating 6'-N-ethylnetilmicin but not 2'-N-ethylnetilmicin, suggesting 2'-N-acetyltransferase activity. DH5alpha/pSCH4500, which contains a subcloned 1.3-kb fragment, also demonstrated an AAC(2')-Ia resistance profile. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Netilmicin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain DH5a | 668369 | ||
Escherichia coli strain XLI-Blue | 562 | |||
Providencia stuartii strain PR50 | 588 | |||
Providencia stuartii strain SCH75082831A | 588 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Microdilution plates assay | |||
Mechanism Description | E.coli DH5alpha/pR 1000 demonstrated an AAC(2')-Ia resistance profile,with gentamicin, tobramycin, netilmicin, and 6'-Nethylnetilmicin MICs increased over those seen with E.coli DH5alpha. In addition, E.coli DH5alpha/pR 1000 did not show an elevated 2'-N-ethylnetilmicin MIC (MIC was 0.25ug/ml). Therefore, pR1000 encoded an enzyme capable of acetylating 6'-N-ethylnetilmicin but not 2'-N-ethylnetilmicin, suggesting 2'-N-acetyltransferase activity. DH5alpha/pSCH4500, which contains a subcloned 1.3-kb fragment, also demonstrated an AAC(2')-Ia resistance profile. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Tobramycin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain DH5a | 668369 | ||
Escherichia coli strain XLI-Blue | 562 | |||
Providencia stuartii strain PR50 | 588 | |||
Providencia stuartii strain SCH75082831A | 588 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Microdilution plates assay | |||
Mechanism Description | E.coli DH5alpha/pR 1000 demonstrated an AAC(2')-Ia resistance profile,with gentamicin, tobramycin, netilmicin, and 6'-Nethylnetilmicin MICs increased over those seen with E.coli DH5alpha. In addition, E.coli DH5alpha/pR 1000 did not show an elevated 2'-N-ethylnetilmicin MIC (MIC was 0.25ug/ml). Therefore, pR1000 encoded an enzyme capable of acetylating 6'-N-ethylnetilmicin but not 2'-N-ethylnetilmicin, suggesting 2'-N-acetyltransferase activity. DH5alpha/pSCH4500, which contains a subcloned 1.3-kb fragment, also demonstrated an AAC(2')-Ia resistance profile. |
Investigative Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | 6'-N-Ethylnetilmicin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain DH5a | 668369 | ||
Escherichia coli strain XLI-Blue | 562 | |||
Providencia stuartii strain PR50 | 588 | |||
Providencia stuartii strain SCH75082831A | 588 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Microdilution plates assay | |||
Mechanism Description | E.coli DH5alpha/pR 1000 demonstrated an AAC(2')-Ia resistance profile,with gentamicin, tobramycin, netilmicin, and 6'-Nethylnetilmicin MICs increased over those seen with E.coli DH5alpha. In addition, E.coli DH5alpha/pR 1000 did not show an elevated 2'-N-ethylnetilmicin MIC (MIC was 0.25ug/ml). Therefore, pR1000 encoded an enzyme capable of acetylating 6'-N-ethylnetilmicin but not 2'-N-ethylnetilmicin, suggesting 2'-N-acetyltransferase activity. DH5alpha/pSCH4500, which contains a subcloned 1.3-kb fragment, also demonstrated an AAC(2')-Ia resistance profile. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Pentisomicin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain DH5a | 668369 | ||
Escherichia coli strain XLI-Blue | 562 | |||
Providencia stuartii strain PR50 | 588 | |||
Providencia stuartii strain SCH75082831A | 588 | |||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Microdilution plates assay | |||
Mechanism Description | E.coli DH5alpha/pR 1000 demonstrated an AAC(2')-Ia resistance profile,with gentamicin, tobramycin, netilmicin, and 6'-Nethylnetilmicin MICs increased over those seen with E.coli DH5alpha. In addition, E.coli DH5alpha/pR 1000 did not show an elevated 2'-N-ethylnetilmicin MIC (MIC was 0.25ug/ml). Therefore, pR1000 encoded an enzyme capable of acetylating 6'-N-ethylnetilmicin but not 2'-N-ethylnetilmicin, suggesting 2'-N-acetyltransferase activity. DH5alpha/pSCH4500, which contains a subcloned 1.3-kb fragment, also demonstrated an AAC(2')-Ia resistance profile. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.