Molecule Information
General Information of the Molecule (ID: Mol00776)
Name |
Aminoglycoside (3'') (9) adenylyltransferase (AADA)
,Pasteurella multocida
|
||||
---|---|---|---|---|---|
Molecule Type |
Protein
|
||||
Gene Name |
aadA14
|
||||
Sequence |
MTNKPPESIAEQVSEARSILENHLETIQAIHLFGSAVDGGLKPFSDIDLLVTVGTPLNES
TRAALMSDLLAVSAFPGTDSKRRALEVTVLTQEDVVPWRYPAKRQMQFGEWLRDDINARI FEPALMDHDLAILLTKVRRHSVALYGPAAHEFFDEIPVVDVQRSLLETLTLWTTEADWKG DERNIVLALVRIWYTAMTGEITSKVAAADWALQRLPREIKSVVIAARDAYLGLEAADLAA YPKERADLRNHIHSSVTAKLQ Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Pasteurella multocida infection | [1] | |||
Resistant Disease | Pasteurella multocida infection [ICD-11: 1B99.0] | |||
Resistant Drug | Spectinomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli JM109 cells | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and DNA sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance. | |||
Disease Class: Mannheimia haemolytica infection | [1] | |||
Resistant Disease | Mannheimia haemolytica infection [ICD-11: CA45.3] | |||
Resistant Drug | Spectinomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli JM109 cells | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and DNA sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance. | |||
Disease Class: Histophilus somni infection | [1] | |||
Resistant Disease | Histophilus somni infection [ICD-11: CA45.2] | |||
Resistant Drug | Spectinomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli JM109 cells | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and DNA sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Pasteurella multocida infection | [1] | |||
Resistant Disease | Pasteurella multocida infection [ICD-11: 1B99.0] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli JM109 cells | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and DNA sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance. | |||
Disease Class: Mannheimia haemolytica infection | [1] | |||
Resistant Disease | Mannheimia haemolytica infection [ICD-11: CA45.3] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli JM109 cells | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and DNA sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance. | |||
Disease Class: Histophilus somni infection | [1] | |||
Resistant Disease | Histophilus somni infection [ICD-11: CA45.2] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli JM109 cells | 562 | ||
Experiment for Molecule Alteration |
PCR amplification and DNA sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.