Molecule Information
General Information of the Molecule (ID: Mol00774)
| Name |
Aminoglycoside (3'') (9) adenylyltransferase (AADA)
,Escherichia coli
|
||||
|---|---|---|---|---|---|
| Synonyms |
aadA; aadA1b; aadA1d; aadA2; aadAI; BO068_004688; BO068_005462; BON66_04400; BON68_01140; BON70_24900; BON72_22960; BON94_27315; BTQ06_25060; CQP61_00015; DAH50_23555; DKP82_26115; GF147_27240; GF147_27245; GQW07_24995; GQW07_26760; GQW07_26780; GRO95_25260; GRO95_26815; GRO95_26835; pO103_87
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
aadA1
|
||||
| Sequence |
MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPHSDIDLLVTVTVRLDE
TTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAG IFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFEALNETLTLWNSPPDWA GDERNVVLTLSRIWYSAVTGRIAPKDVAADWAMERLPAQYQPVILEARQAYLGQEEDRLA SRADQLEEFVHYVKGEITKVVGK Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Urinary tract infection [ICD-11: GC08.1] | [1] | |||
| Resistant Disease | Urinary tract infection [ICD-11: GC08.1] | |||
| Resistant Drug | Ampicillin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli serogroup O11 | 1095705 | ||
| Escherichia coli serogroup O17 | 1010800 | |||
| Escherichia coli serogroup O73 | 2170725 | |||
| Escherichia coli serogroup O77 | 562 | |||
| Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
| Experiment for Drug Resistance |
Microdilution method assay | |||
| Mechanism Description | All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Urinary tract infection [ICD-11: GC08.1] | [1] | |||
| Resistant Disease | Urinary tract infection [ICD-11: GC08.1] | |||
| Resistant Drug | Ciprofloxacin XR | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli serogroup O11 | 1095705 | ||
| Escherichia coli serogroup O17 | 1010800 | |||
| Escherichia coli serogroup O73 | 2170725 | |||
| Escherichia coli serogroup O77 | 562 | |||
| Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
| Experiment for Drug Resistance |
Microdilution method assay | |||
| Mechanism Description | All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Urinary tract infection [ICD-11: GC08.1] | [1] | |||
| Resistant Disease | Urinary tract infection [ICD-11: GC08.1] | |||
| Resistant Drug | Co-trimoxazole | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli serogroup O11 | 1095705 | ||
| Escherichia coli serogroup O17 | 1010800 | |||
| Escherichia coli serogroup O73 | 2170725 | |||
| Escherichia coli serogroup O77 | 562 | |||
| Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
| Experiment for Drug Resistance |
Microdilution method assay | |||
| Mechanism Description | All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Urinary tract infection [ICD-11: GC08.1] | [1] | |||
| Resistant Disease | Urinary tract infection [ICD-11: GC08.1] | |||
| Resistant Drug | Gentamicin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli serogroup O11 | 1095705 | ||
| Escherichia coli serogroup O17 | 1010800 | |||
| Escherichia coli serogroup O73 | 2170725 | |||
| Escherichia coli serogroup O77 | 562 | |||
| Experiment for Molecule Alteration |
PCR amplification and sequence alignments assay | |||
| Experiment for Drug Resistance |
Microdilution method assay | |||
| Mechanism Description | All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [2] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli Co227 | 562 | ||
| Escherichia coli Co228 | 562 | |||
| Escherichia coli Co232 | 562 | |||
| Escherichia coli Co354 | 562 | |||
| Experiment for Molecule Alteration |
PCR; PCR-restriction fragment length polymorphism analysis; Sequencing assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Multiple-antibiotic-resistant phenotype is associated with gene mutation and mar locus regulation. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
