Molecule Information
      General Information of the Molecule (ID: Mol00773)
  
  | Name | Aminoglycoside (3'') (9) adenylyltransferase (AADA)
                                ,Salmonella enterica serovar Typhimurium
                               | ||||
|---|---|---|---|---|---|
| Molecule Type | Protein | ||||
| Gene Name | aadA21 | ||||
| Sequence | MRVAVTIEISNQLSEVLSVIERHLESTLLAVHLYGSAVDGGLKPYSDIDLLVTVTVRLDE TTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAG IFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFEALNETLTLWNSPPDWA GDERNVVLTLSRIWYSAVTGKIAPKDVARDWAMERLPAQYQPVILEARQAYLGQEEDRLA SRADQLEEFVHYVKGEITKVVGK     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      2 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Salmonella enterica infection | [1] | |||
| Resistant Disease | Salmonella enterica infection [ICD-11: 1A09.0] | |||
| Resistant Drug | Spectinomycin | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Salmonella enterica serovar typhimurium strain | 90371 | ||
| Experiment for Molecule Alteration | PCR | |||
| Experiment for Drug Resistance | Disk diffusion method assay | |||
| Mechanism Description | Besides the genes present in the multidrug-resistant Salmonella serovar Typhimurium strains, other genes related to antibiotic resistance were described in Salmonella serovar Typhimurium or other closely related species. Tetracycline resistance could also be encoded by tetA, tetB, tetC or aadA21. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Salmonella enterica infection | [1] | |||
| Resistant Disease | Salmonella enterica infection [ICD-11: 1A09.0] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Salmonella enterica serovar typhimurium strain | 90371 | ||
| Experiment for Molecule Alteration | PCR | |||
| Experiment for Drug Resistance | Disk diffusion method assay | |||
| Mechanism Description | Besides the genes present in the multidrug-resistant Salmonella serovar Typhimurium strains, other genes related to antibiotic resistance were described in Salmonella serovar Typhimurium or other closely related species. Tetracycline resistance could also be encoded by tetA, tetB, tetC or aadA21. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
