General Information of the Molecule (ID: Mol00773)
Name
Aminoglycoside (3'') (9) adenylyltransferase (AADA) ,Salmonella enterica serovar Typhimurium
Molecule Type
Protein
Gene Name
aadA21
Sequence
MRVAVTIEISNQLSEVLSVIERHLESTLLAVHLYGSAVDGGLKPYSDIDLLVTVTVRLDE
TTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAG
IFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFEALNETLTLWNSPPDWA
GDERNVVLTLSRIWYSAVTGKIAPKDVARDWAMERLPAQYQPVILEARQAYLGQEEDRLA
SRADQLEEFVHYVKGEITKVVGK
    Click to Show/Hide
Uniprot ID
Q8GCH1_SALTM
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Salmonella
Species: Salmonella enterica subsp. enterica serovar Typhimurium
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Spectinomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Salmonella enterica infection [ICD-11: 1A09.0] [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Spectinomycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar typhimurium strain 90371
Experiment for
Molecule Alteration
PCR
Experiment for
Drug Resistance
Disk diffusion method assay
Mechanism Description Besides the genes present in the multidrug-resistant Salmonella serovar Typhimurium strains, other genes related to antibiotic resistance were described in Salmonella serovar Typhimurium or other closely related species. Tetracycline resistance could also be encoded by tetA, tetB, tetC or aadA21.
Streptomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Salmonella enterica infection [ICD-11: 1A09.0] [1]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Streptomycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar typhimurium strain 90371
Experiment for
Molecule Alteration
PCR
Experiment for
Drug Resistance
Disk diffusion method assay
Mechanism Description Besides the genes present in the multidrug-resistant Salmonella serovar Typhimurium strains, other genes related to antibiotic resistance were described in Salmonella serovar Typhimurium or other closely related species. Tetracycline resistance could also be encoded by tetA, tetB, tetC or aadA21.
References
Ref 1 Evolution of antibiotic resistance in Salmonella enterica serovar typhimurium strains isolated in the Czech Republic between 1984 and 2002. Antimicrob Agents Chemother. 2003 Jun;47(6):2002-5. doi: 10.1128/AAC.47.6.2002-2005.2003.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.