Molecule Information
      General Information of the Molecule (ID: Mol00770)
  
  | Name | Aminocyclitol acetyltransferase ApmA (APMA)
                                ,Staphylococcus aureus
                               | ||||
|---|---|---|---|---|---|
| Synonyms | apmA; Aminocyclitol acetyltransferase ApmA     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | apmA | ||||
| Sequence | MKTRLEQVLERYLNGREVAVWGVPTRRLLRALKPFKFHTADRVDPQYHYVVAVTDDDLTD FLSDEQSKSFQYANDYLTFDDEGGELPFERMCFNVPVGRQTYFGDGVVGACENGYIKSIG QFTSINGTAEIHANHQLNMTFVSDDIQNFFNEESMAVFQEKLRKDPKHPYAYSKEPMTIG SDVYIGAHAFINASTVTSIGDGAIIGSGAVVLENVPPFAVVVGVPARIKRYRFSKEMIET LLRVKWWDWSIEEINENVDALISPELFMKKYGSL     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Clinical Trial Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Apramycin | |||
| Molecule Alteration | Expression | Up-regulation | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Staphylococcus aureus RN4220 | 1280 | ||
| Escherichia coli JM101 | 562 | |||
| Staphylococcus aureus ST398 | 523796 | |||
| Experiment for Molecule Alteration | Whole genome sequence assay; Allelic frequency measurement assay | |||
| Experiment for Drug Resistance | Broth microdilution method assay | |||
| Mechanism Description | The apmA gene coded for a protein of 274 amino acids that was related only distantly to acetyltransferases involved in chloramphenicol or streptogramin A resistance. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
