Molecule Information
General Information of the Molecule (ID: Mol00765)
Name |
ABC transporter ATP-binding/permease protein YojI (YOJI)
,Escherichia coli
|
||||
---|---|---|---|---|---|
Synonyms |
yojJ; b2211; JW2199
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
yojI
|
||||
Gene ID | |||||
Sequence |
MELLVLVWRQYRWPFISVMALSLASAALGIGLIAFINQRLIETADTSLLVLPEFLGLLLL
LMAVTLGSQLALTTLGHHFVYRLRSEFIKRILDTHVERIEQLGSASLLAGLTSDVRNITI AFVRLPELVQGIILTIGSAAYLWMLSGKMLLVTAIWMAITIWGGFVLVARVYKHMATLRE TEDKLYTDFQTVLEGRKELTLNRERAEYVFNNLYIPDAQEYRHHIIRADTFHLSAVNWSN IMMLGAIGLVFWMANSLGWADTNVAATYSLTLLFLRTPLLSAVGALPTLLTAQVAFNKLN KFALAPFKAEFPRPQAFPNWQTLELRNVTFAYQDNAFSVGPINLTIKRGELLFLIGGNGS GKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDYRKLFSAVFTDVWLFDQLLGPEGKPA NPQLVEKWLAQLKMAHKLELSNGRIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQ DPHFRREFYQVLLPLMQEMGKTIFAISHDDHYFIHADRLLEMRNGQLSELTGEERDAASR DAVARTA Click to Show/Hide
|
||||
Function |
Mediates resistance to the antibacterial peptide microcin J25, when expressed from a multicopy vector. Functions as an efflux pump for microcin J25, with the help of the outer membrane channel TolC.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Microcin J25 | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli k-12 | 83333 | ||
Experiment for Molecule Alteration |
Promega and one-step chromosomal gene inactivation method assay | |||
Experiment for Drug Resistance |
Spot-on-lawn assay | |||
Mechanism Description | YojI, an Escherichia coli open reading frame with an unknown function, mediates resistance to the peptide antibiotic microcin J25 when it is expressed from a multicopy vector. Disruption of the single chromosomal copy of yojI increased sensitivity of cells to microcin J25. One obvious explanation for the protective effect against microcin J25 is that YojI action keeps the intracellular concentration of the peptide below a toxic level. the resistance to MccJ25 mediated by YojI involves extrusion of the peptide and that YojI is assisted by the multifunctional outer membrane protein TolC. | |||
Disease Class: Salmonella enterica infection | [1] | |||
Resistant Disease | Salmonella enterica infection [ICD-11: 1A09.0] | |||
Resistant Drug | Microcin J25 | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli k-12 | 83333 | ||
Experiment for Molecule Alteration |
Promega and one-step chromosomal gene inactivation method assay | |||
Experiment for Drug Resistance |
Spot-on-lawn assay | |||
Mechanism Description | YojI, an Escherichia coli open reading frame with an unknown function, mediates resistance to the peptide antibiotic microcin J25 when it is expressed from a multicopy vector. Disruption of the single chromosomal copy of yojI increased sensitivity of cells to microcin J25. One obvious explanation for the protective effect against microcin J25 is that YojI action keeps the intracellular concentration of the peptide below a toxic level. the resistance to MccJ25 mediated by YojI involves extrusion of the peptide and that YojI is assisted by the multifunctional outer membrane protein TolC. | |||
Disease Class: Shigella intestinal infection | [1] | |||
Resistant Disease | Shigella intestinal infection [ICD-11: 1A02.0] | |||
Resistant Drug | Microcin J25 | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli k-12 | 83333 | ||
Experiment for Molecule Alteration |
Promega and one-step chromosomal gene inactivation method assay | |||
Experiment for Drug Resistance |
Spot-on-lawn assay | |||
Mechanism Description | YojI, an Escherichia coli open reading frame with an unknown function, mediates resistance to the peptide antibiotic microcin J25 when it is expressed from a multicopy vector. Disruption of the single chromosomal copy of yojI increased sensitivity of cells to microcin J25. One obvious explanation for the protective effect against microcin J25 is that YojI action keeps the intracellular concentration of the peptide below a toxic level. the resistance to MccJ25 mediated by YojI involves extrusion of the peptide and that YojI is assisted by the multifunctional outer membrane protein TolC. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.