Molecule Information
General Information of the Molecule (ID: Mol00764)
| Name |
ABC transporter ATP-binding protein (ABCP)
,Enterococcus faecium
|
||||
|---|---|---|---|---|---|
| Synonyms |
B1P95_04040; B4W81_01075; BU194_12630; DKP91_00610; DPX29_03150; DTPHA_1400158; GBM44_03070; GBM73_06715; A); Lsa family ABC-F type ribosomal protection protein
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
B1P95_04040
|
||||
| Gene ID | |||||
| Sequence |
MSKIEIKNLTFGYDSQGTLLFEQANLNFDTQWKLGLIGRNGRGKTTLLNILQNKLPYQGQ
VIHQQEFAYFPQQTKDKERLTYYVLNDITDFEIWEIERELQLMQTDPEILWREFSTLSGG EKTKVLLALLFVDDTHFPLIDEPTNHLDISGRKQVAAYLKKKKQGFIVVSHDRGFIDEVV DHVLAIEKSQLELYQGNFSIYEEQKKLRDEFEMAQNEKLKKEVSRLKKTAAEKAEWSRSR EGDKTKKQVGFIDTESRRVNKGAVGADAARTMKRSKAIVNRMETQISEKEKLLKDIEYID SLTMNSQASHHKRLLSVEDLQLGYENLLFEPIHFTIEPHQRVAISGPNGAGKSSIIHYLL GAFNGKVIGEKYQPKHLSISYASQNYEDNRGTLAEFAEKNQVDYQAFLNNLRKLGMERDV FHNKIEQMSMGQRKKVELAKSLSQPAELYTWDEPLNYLDVFNQEQLEQLILNVKPAMLLV EHDQTFLDKVSTEIISLERI Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Clindamycin | |||
| Molecule Alteration | Missense mutation | p.T450I |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Enterococcus faecium HM1070 | 1352 | |||
| Enterococcus faecium UCN80 | 1352 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Mechanism Description | ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Dalfopristin | |||
| Molecule Alteration | Missense mutation | p.T450I |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Enterococcus faecium HM1070 | 1352 | |||
| Enterococcus faecium UCN80 | 1352 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Mechanism Description | ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Lincomycin | |||
| Molecule Alteration | Missense mutation | p.T450I |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Enterococcus faecium HM1070 | 1352 | |||
| Enterococcus faecium UCN80 | 1352 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Mechanism Description | ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Tiamulin | |||
| Molecule Alteration | Missense mutation | p.T450I |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Enterococcus faecium HM1070 | 1352 | |||
| Enterococcus faecium UCN80 | 1352 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Mechanism Description | ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins. | |||
Investigative Drug(s)
2 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Pleuromutilins | |||
| Molecule Alteration | Missense mutation | p.T450I |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Enterococcus faecium HM1070 | 1352 | |||
| Enterococcus faecium UCN80 | 1352 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Mechanism Description | ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Quinupristin/Dalfopristin | |||
| Molecule Alteration | Missense mutation | p.T450I |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Enterococcus faecium HM1070 | 1352 | |||
| Enterococcus faecium UCN80 | 1352 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Mechanism Description | ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
