General Information of the Molecule (ID: Mol00764)
Name
ABC transporter ATP-binding protein (ABCP) ,Enterococcus faecium
Synonyms
B1P95_04040; B4W81_01075; BU194_12630; DKP91_00610; DPX29_03150; DTPHA_1400158; GBM44_03070; GBM73_06715; A); Lsa family ABC-F type ribosomal protection protein
    Click to Show/Hide
Molecule Type
Protein
Gene Name
B1P95_04040
Gene ID
66453566
Sequence
MSKIEIKNLTFGYDSQGTLLFEQANLNFDTQWKLGLIGRNGRGKTTLLNILQNKLPYQGQ
VIHQQEFAYFPQQTKDKERLTYYVLNDITDFEIWEIERELQLMQTDPEILWREFSTLSGG
EKTKVLLALLFVDDTHFPLIDEPTNHLDISGRKQVAAYLKKKKQGFIVVSHDRGFIDEVV
DHVLAIEKSQLELYQGNFSIYEEQKKLRDEFEMAQNEKLKKEVSRLKKTAAEKAEWSRSR
EGDKTKKQVGFIDTESRRVNKGAVGADAARTMKRSKAIVNRMETQISEKEKLLKDIEYID
SLTMNSQASHHKRLLSVEDLQLGYENLLFEPIHFTIEPHQRVAISGPNGAGKSSIIHYLL
GAFNGKVIGEKYQPKHLSISYASQNYEDNRGTLAEFAEKNQVDYQAFLNNLRKLGMERDV
FHNKIEQMSMGQRKKVELAKSLSQPAELYTWDEPLNYLDVFNQEQLEQLILNVKPAMLLV
EHDQTFLDKVSTEIISLERI
    Click to Show/Hide
Uniprot ID
S5FVG4_ENTFC
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus faecalis
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
Clindamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Clindamycin
Molecule Alteration Missense mutation
p.T450I
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Enterococcus faecium HM1070 1352
Enterococcus faecium UCN80 1352
Experiment for
Molecule Alteration
Whole genome sequence assay
Mechanism Description ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins.
Dalfopristin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Dalfopristin
Molecule Alteration Missense mutation
p.T450I
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Enterococcus faecium HM1070 1352
Enterococcus faecium UCN80 1352
Experiment for
Molecule Alteration
Whole genome sequence assay
Mechanism Description ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins.
Lincomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Lincomycin
Molecule Alteration Missense mutation
p.T450I
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Enterococcus faecium HM1070 1352
Enterococcus faecium UCN80 1352
Experiment for
Molecule Alteration
Whole genome sequence assay
Mechanism Description ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins.
Tiamulin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Tiamulin
Molecule Alteration Missense mutation
p.T450I
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Enterococcus faecium HM1070 1352
Enterococcus faecium UCN80 1352
Experiment for
Molecule Alteration
Whole genome sequence assay
Mechanism Description ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins.
Investigative Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Pleuromutilins
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Pleuromutilins
Molecule Alteration Missense mutation
p.T450I
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Enterococcus faecium HM1070 1352
Enterococcus faecium UCN80 1352
Experiment for
Molecule Alteration
Whole genome sequence assay
Mechanism Description ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins.
Quinupristin/Dalfopristin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Quinupristin/Dalfopristin
Molecule Alteration Missense mutation
p.T450I
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli TOP10 83333
Enterococcus faecium HM1070 1352
Enterococcus faecium UCN80 1352
Experiment for
Molecule Alteration
Whole genome sequence assay
Mechanism Description ABC systems constitute one of the largest families of proteins, with most of them being involved in import and export, often called ABC transporters.Several of these class 2 ABC systems have been involved in MLS resistance, such as Msr-, Vga-, or Lsa-like proteins.The observed profile of cross-resistance to lincosamides, streptogramins A, and pleuromutilins conferred by Eat(A)v was similar to those conferred by other Lsa-like proteins.
References
Ref 1 Comparative analysis of the first complete Enterococcus faecium genome. J Bacteriol. 2012 May;194(9):2334-41. doi: 10.1128/JB.00259-12. Epub 2012 Feb 24.
Ref 2 Genetic basis for in vitro and in vivo resistance to lincosamides, streptogramins A, and pleuromutilins (LSAP phenotype) in Enterococcus faecium. Antimicrob Agents Chemother. 2013 Sep;57(9):4463-9. doi: 10.1128/AAC.01030-13. Epub 2013 Jul 8.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.