Molecule Information
General Information of the Molecule (ID: Mol00760)
| Name |
ABC superfamily ATP binding cassette transporter (ABCCT)
,Staphylococcus sciuri
|
||||
|---|---|---|---|---|---|
| Synonyms |
sal(A); ABC superfamily ATP binding cassette transporter
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
sal(A)
|
||||
| Sequence |
MLFLFEEKALEVEHKVLIPELTFSIEDHEHLAIVGVNGVGKSTLLKVIHQDQSVDSAMME
QDLTPYYDWTVMDYIIESYPEIAKIRLQLNHTDMINKYIELDGYIIEGEIVTEAKKLGIK EEQLEQKISTLSGGEQTKVSFLKVKMSKASLLLIDEPTNHMDLEMKEWLTKAFKQEQRAI LFVSHDRTFLNETPDAILELSLDGAKKYIGKYDKYKQQKDIEHETLKLQYEKQQKEQAAI EETIKKYKAWYQKAEQSASVRSPYQQKQLSKLAKRFKSKEQQLNRKLDQEHIPNPHKKEK TFSIQHHNFKSHYLVQFNHVSFAYDNRKIFDDVSFYIKRNQNVIVEGRNGTGKSTLIKLI LGELEPTKGDITVHPELEIGYFSQDFENLNMHHTVLDEILEIPEMKEADARTILASFYFD KDRINDVVETLSMGEKCRLQFVKLYFSNPHIMILDEPTNYFDIGMQENIIQLIQSFQGSV LIVSHDNYFKSQIKDQTWTIKNHQMTHENVQVKDPINTESMKHHLKELEQYTDERNRETE F Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Lincomycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Staphylococcus aureus RN4220 | 1280 | |||
| Staphylococcus saprophyticus ATCC 15305 | 342451 | |||
| Staphylococcus sciuri ATCC 29059 | 1296 | |||
| Staphylococcus sciuri ATCC 29062 | 1296 | |||
| Staphylococcus sciuri ATCC 700058 | 1296 | |||
| Staphylococcus sciuri ATCC 700061 | 1296 | |||
| Staphylococcus sciuri BL2 | 1296 | |||
| Staphylococcus sciuri SS226 | 1296 | |||
| Staphylococcus sciuri SVv1 | 1296 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | Efflux-mediated resistance to MLS antibiotics in staphylococci relies on the ATPase activity of a very special kind of ATP-binding cassette (ABC) protein.By whole-genome sequencing of strain ATCC 29059, we identified a candidate gene that encodes an ATP-binding cassette protein similar to the Lsa and VmlR resistance determinants. Isolation and reverse transcription-quantitative PCR (qRT-PCR) expression studies confirmed that Sal(A) can confer a moderate resistance to lincosamides (8 times the MIC of lincomycin) and a high-level resistance to streptogramins A. The chromosomal location of sal(A) between two housekeeping genes of the staphylococcal core genome supports the gene's ancient origins and thus innate resistance to these antimicrobials within S. sciuri subspecies. | |||
Investigative Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1], [2] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Pristinamycin IIA | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli TOP10 | 83333 | ||
| Staphylococcus aureus RN4220 | 1280 | |||
| Staphylococcus saprophyticus ATCC 15305 | 342451 | |||
| Staphylococcus sciuri ATCC 29059 | 1296 | |||
| Staphylococcus sciuri ATCC 29062 | 1296 | |||
| Staphylococcus sciuri ATCC 700058 | 1296 | |||
| Staphylococcus sciuri ATCC 700061 | 1296 | |||
| Staphylococcus sciuri BL2 | 1296 | |||
| Staphylococcus sciuri SS226 | 1296 | |||
| Staphylococcus sciuri SVv1 | 1296 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | Efflux-mediated resistance to MLS antibiotics in staphylococci relies on the ATPase activity of a very special kind of ATP-binding cassette (ABC) protein.By whole-genome sequencing of strain ATCC 29059, we identified a candidate gene that encodes an ATP-binding cassette protein similar to the Lsa and VmlR resistance determinants. Isolation and reverse transcription-quantitative PCR (qRT-PCR) expression studies confirmed that Sal(A) can confer a moderate resistance to lincosamides (8 times the MIC of lincomycin) and a high-level resistance to streptogramins A. The chromosomal location of sal(A) between two housekeeping genes of the staphylococcal core genome supports the gene's ancient origins and thus innate resistance to these antimicrobials within S. sciuri subspecies. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
