Molecule Information
General Information of the Molecule (ID: Mol00759)
Name |
AADA9 protein (AADA9)
,Corynebacterium glutamicum
|
||||
---|---|---|---|---|---|
Synonyms |
aadA9; AADA9 protein
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aadA9
|
||||
Sequence |
MSNSIHTGISRQLSQARDVIKRHLASTLKAIHLYGSAIDGGLKPYSDIDLLVTVDARLDE
ATRRSLMLDFLNISAPPCESSILRPLEVTVVACNEVVPWRYPARRELQFGEWLREDILEG VFEPAALDADLAILITKARQHSIALVGPVAQKVFMPVPEHDFLQVLSDTLKLWNTHEDWE NEERNIVLTLARIWYSTETGGIVPKDVAAEWVLERLPAEHKPILVEARQAYLGLCKDSLA LRADETSAFIGYAKSAVADLLEKRKSQTSHICDGAKNV Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Corynebacterium glutamicum infection | [1] | |||
Resistant Disease | Corynebacterium glutamicum infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Spectinomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Corynebacterium glutamicum ATCC 13032 | 196627 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | AadA9 is a novel aminoglycoside adenyltransferase gene cassette which lead to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Corynebacterium glutamicum infection | [1] | |||
Resistant Disease | Corynebacterium glutamicum infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Corynebacterium glutamicum ATCC 13032 | 196627 | ||
Experiment for Molecule Alteration |
DNA sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | AadA9 is a novel aminoglycoside adenyltransferase gene cassette which lead to drug resistance. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.