Molecule Information

General Information of the Molecule (ID: Mol00757)

Name	AacA43 aminoglycoside (AACA43) ,Klebsiella pneumoniae
Synonyms	aacA43; 6') acetyltransferase Click to Show/Hide
Molecule Type	Protein
Gene Name	aacA43
Sequence	MIYNIINIADSEKNKEDAARILYSAFRGKGKDAWPTLDSAREEIAECIASPNICLGITLD DRLVGWGGLRPMYETTWELHPLVIDPDYQGNGLGRLLLSKIESTATTNRIIGIMLGTDDE TLSTSLSMTDIDESNIFQEIKNIINIKNHPFEFYKKCGYIIVGIVPNANGYRKPDIWMWK NLEKKSG Click to Show/Hide
Uniprot ID	F2WU95_KLEPN
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Klebsiella Species: Klebsiella pneumoniae

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Kanamycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Kanamycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Klebsiella pneumoniae LT12		573
	Klebsiella pneumoniae SSI2.46		573
Experiment for Molecule Alteration	Whole genome sequence assay; Allelic frequency measurement assay
Experiment for Drug Resistance	Broth microdilution method assay
Mechanism Description	Like related aminoglycoside-(6')-acetyltransferases, AacA43 confers clinically relevant resistance to kanamycin, tobramycin, and some less-used aminoglycosides but not to gentamicin.

Tobramycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Tobramycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Klebsiella pneumoniae LT12		573
	Klebsiella pneumoniae SSI2.46		573
Experiment for Molecule Alteration	Whole genome sequence assay; Allelic frequency measurement assay
Experiment for Drug Resistance	Broth microdilution method assay
Mechanism Description	Like related aminoglycoside-(6')-acetyltransferases, AacA43 confers clinically relevant resistance to kanamycin, tobramycin, and some less-used aminoglycosides but not to gentamicin.

References

Ref 1	A novel gene cassette, aacA43, in a plasmid-borne class 1 integron. Antimicrob Agents Chemother. 2011 Jun;55(6):2979-82. doi: 10.1128/AAC.01582-10. Epub 2011 Mar 21.