General Information of the Molecule (ID: Mol00757)
Name
AacA43 aminoglycoside (AACA43) ,Klebsiella pneumoniae
Synonyms
aacA43; 6') acetyltransferase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
aacA43
Sequence
MIYNIINIADSEKNKEDAARILYSAFRGKGKDAWPTLDSAREEIAECIASPNICLGITLD
DRLVGWGGLRPMYETTWELHPLVIDPDYQGNGLGRLLLSKIESTATTNRIIGIMLGTDDE
TLSTSLSMTDIDESNIFQEIKNIINIKNHPFEFYKKCGYIIVGIVPNANGYRKPDIWMWK
NLEKKSG
    Click to Show/Hide
Uniprot ID
F2WU95_KLEPN
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Klebsiella
Species: Klebsiella pneumoniae
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Kanamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Kanamycin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Klebsiella pneumoniae LT12 573
Klebsiella pneumoniae SSI2.46 573
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description Like related aminoglycoside-(6')-acetyltransferases, AacA43 confers clinically relevant resistance to kanamycin, tobramycin, and some less-used aminoglycosides but not to gentamicin.
Tobramycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Tobramycin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Klebsiella pneumoniae LT12 573
Klebsiella pneumoniae SSI2.46 573
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description Like related aminoglycoside-(6')-acetyltransferases, AacA43 confers clinically relevant resistance to kanamycin, tobramycin, and some less-used aminoglycosides but not to gentamicin.
References
Ref 1 A novel gene cassette, aacA43, in a plasmid-borne class 1 integron. Antimicrob Agents Chemother. 2011 Jun;55(6):2979-82. doi: 10.1128/AAC.01582-10. Epub 2011 Mar 21.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.