Molecule Information
General Information of the Molecule (ID: Mol00757)
Name |
AacA43 aminoglycoside (AACA43)
,Klebsiella pneumoniae
|
||||
---|---|---|---|---|---|
Synonyms |
aacA43; 6') acetyltransferase
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aacA43
|
||||
Sequence |
MIYNIINIADSEKNKEDAARILYSAFRGKGKDAWPTLDSAREEIAECIASPNICLGITLD
DRLVGWGGLRPMYETTWELHPLVIDPDYQGNGLGRLLLSKIESTATTNRIIGIMLGTDDE TLSTSLSMTDIDESNIFQEIKNIINIKNHPFEFYKKCGYIIVGIVPNANGYRKPDIWMWK NLEKKSG Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Klebsiella pneumoniae LT12 | 573 | ||
Klebsiella pneumoniae SSI2.46 | 573 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | Like related aminoglycoside-(6')-acetyltransferases, AacA43 confers clinically relevant resistance to kanamycin, tobramycin, and some less-used aminoglycosides but not to gentamicin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Tobramycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Klebsiella pneumoniae LT12 | 573 | ||
Klebsiella pneumoniae SSI2.46 | 573 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | Like related aminoglycoside-(6')-acetyltransferases, AacA43 confers clinically relevant resistance to kanamycin, tobramycin, and some less-used aminoglycosides but not to gentamicin. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.