General Information of the Molecule (ID: Mol00756)
Name
30S ribosomal protein S12 (RPSL) ,Mycobacterium tuberculosis
Synonyms
rps12; Rv0682; MTV040.10
    Click to Show/Hide
Molecule Type
Protein
Gene Name
rpsL
Gene ID
45424644
Sequence
MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQ
VEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAK
KEKG
    Click to Show/Hide
Function
Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity).
    Click to Show/Hide
Uniprot ID
RS12_MYCTU
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Corynebacteriales
Family: Mycobacteriaceae
Genus: Mycobacterium
Species: Mycobacterium tuberculosis
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Streptomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: HIV-infected patients with tuberculosis [1], [2], [3]
Resistant Disease HIV-infected patients with tuberculosis [ICD-11: 1C60.0]
Resistant Drug Streptomycin
Molecule Alteration Mutantion
p.K43R+p.K88Q+p.K88R
Experimental Note Identified from the Human Clinical Data
In Vitro Model Mycobacterium tuberculosis strain 1773
Experiment for
Molecule Alteration
Whole genome sequence assay
Mechanism Description Mycobacterium tuberculosis is associated either with missense mutations in the rpsL gene, which encodes ribosomal protein S12, or with base substitutions at position 904 in the 16S rRNA.Streptomycin resistant isolates harbored mutations in rpsL (codons k43R, k88Q, k88R) and rrs (nucleotide A514C).
References
Ref 1 Molecular characterisation of streptomycin-resistant Mycobacterium tuberculosis strains isolated in Poland. Int J Tuberc Lung Dis. 2004 Aug;8(8):1032-5.
Ref 2 Loss of a conserved 7-methylguanosine modification in 16S rRNA confers low-level streptomycin resistance in bacteria. Mol Microbiol. 2007 Feb;63(4):1096-106. doi: 10.1111/j.1365-2958.2006.05585.x.
Ref 3 Drug resistance-conferring mutations in Mycobacterium tuberculosis from Madang, Papua New Guinea. BMC Microbiol. 2012 Sep 4;12:191. doi: 10.1186/1471-2180-12-191.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.