Molecule Information
General Information of the Molecule (ID: Mol00756)
| Name |
30S ribosomal protein S12 (RPSL)
,Mycobacterium tuberculosis
|
||||
|---|---|---|---|---|---|
| Synonyms |
rps12; Rv0682; MTV040.10
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
rpsL
|
||||
| Gene ID | |||||
| Sequence |
MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQ
VEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAK KEKG Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity).
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: HIV-infected patients with tuberculosis [ICD-11: 1C60.0] | [1], [2], [3] | |||
| Resistant Disease | HIV-infected patients with tuberculosis [ICD-11: 1C60.0] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Mutantion | p.K43R+p.K88Q+p.K88R |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Mycobacterium tuberculosis strain | 1773 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Mechanism Description | Mycobacterium tuberculosis is associated either with missense mutations in the rpsL gene, which encodes ribosomal protein S12, or with base substitutions at position 904 in the 16S rRNA.Streptomycin resistant isolates harbored mutations in rpsL (codons k43R, k88Q, k88R) and rrs (nucleotide A514C). | |||
| Disease Class: bifidobacterium adolescentis infection [ICD-11: XN33F] | [4] | |||
| Resistant Disease | bifidobacterium adolescentis infection [ICD-11: XN33F] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Missense mutation | A98G+K103N+P225H |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | Bifidobacterial strains | 1763 | ||
| Experiment for Molecule Alteration |
PCR; Catalase foam assay; Catalase gel assay | |||
| Experiment for Drug Resistance |
Growth curve assay; Spot assay; Anti-tubercular drug uptake and surface assay; Adaptability assay; FE-SEM assay; MIC assay; Particle size assay | |||
| Mechanism Description | The current study aims to understand the resistance of Bifidobacterium adolescentis to different anti-tubercular drugs (first-line oral tuberculosis drugs). The bacteria were grown with anti-tubercular drugs such as isoniazid, pyrazinamide, and streptomycin to better understand the resistance phenomena. It was found that even at tenfold higher concentrations, growth rates remained unchanged. In addition, a small number of bacteria were found to aggregate strongly, a property that protects against the toxicity of the drug. Further FE-SEM (Field Emission Scanning Electron Microscopy) analysis revealed that some bacteria became excessively long, elongated, and protruded on the surface. Size scattering analysis confirmed the presence of bifidobacteria in the size range of 1.0-100 um. After whole genome sequence analysis, certain mutations were found in the relevant gene. In vitro, foam formation and growth in the presence of H2O2 and HPLC (High Performance Liquid Chromatography) studies provide additional evidence for the presence of catalase. According to RAST (Rapid Annotation Using Subsystems Technology) annotation and CARD (Comprehensive Antibiotic Resistance Database analysis), there were not many components in the genome that were resistant to antibiotics. Whole genome sequence (WGS) analysis does not show the presence of bacteriocins and antibiotic resistance genes, but few hypothetical proteins were observed. 3D structure and docking studies suggest their interaction with specific ligands. | |||
|
|
||||
| Disease Class: Tuberculosis [ICD-11: 1B10.0] | [5] | |||
| Resistant Disease | Tuberculosis [ICD-11: 1B10.0] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Mutation | Q24K+L28M+R30E+A92K |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Experiment for Molecule Alteration |
GeneSeq assay; Bioinformatics assay | |||
| Mechanism Description | Out of total 112 mycobacterial positive cultures, five?M. bovis?were isolated and underwent WGS. All sequenced strains belonged to?Mycobacterium tuberculosis var bovis, spoligotype BOV_1; BOV_11. Resistance gene mutations were determined in 100% of strains to pyrazinamide (pncA?and?rpsA), isoniazid (KatG?and?ahpC), ethambutol (embB,?embC,?embR?and?ubiA), streptomycin (rpsl) and fluoroquinolones (gyrA?and?gyrB). Rifampin (rpoB?and?rpoC) and delamanid (fbiC) resistance genes were found in 80% of strains. The major represented virulence classes were the secretion system, cell surface components and regulation system. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
