Molecule Information
General Information of the Molecule (ID: Mol00756)
Name |
30S ribosomal protein S12 (RPSL)
,Mycobacterium tuberculosis
|
||||
---|---|---|---|---|---|
Synonyms |
rps12; Rv0682; MTV040.10
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
rpsL
|
||||
Gene ID | |||||
Sequence |
MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQ
VEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAK KEKG Click to Show/Hide
|
||||
Function |
Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity).
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: HIV-infected patients with tuberculosis | [1], [2], [3] | |||
Resistant Disease | HIV-infected patients with tuberculosis [ICD-11: 1C60.0] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Mutantion | p.K43R+p.K88Q+p.K88R |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium tuberculosis strain | 1773 | ||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | Mycobacterium tuberculosis is associated either with missense mutations in the rpsL gene, which encodes ribosomal protein S12, or with base substitutions at position 904 in the 16S rRNA.Streptomycin resistant isolates harbored mutations in rpsL (codons k43R, k88Q, k88R) and rrs (nucleotide A514C). |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.