General Information of the Molecule (ID: Mol00754)
Name
23S rRNA (adenosine(1067)-2'-O)-methyltransferase (TSNR) ,Streptomyces laurentii
Synonyms
23S rRNA [AM1067] 2'-O-methyltransferase; 23S rRNA methylase; Thiostrepton-resistance methylase; rRNA (adenosine-2'-O)-methyltransferase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
tsnR
Sequence
MANLDVIVDRSDPAVQRIVDVTKHSRSVVRTVLIEDIEPLTQSIRAGVEFTEVYGLDTVP
FPGDLLAACEKRGIRVRLLSAAVANQVFKTEKKPKVFGIAKVPPAGRFADLESLSGDVVL
LDGVKIVGNIGAIVRTRSALGAAGIVLVDSGLGTIADRRLIRASRGYVFSLPIVLATRDE
ALAFFRDGGMRPVVFEADGKLSIGELDGIDERLVLVFGSEKTGPSGEFAGVATESVSIPM
NPAAESLNVSVSAGIALHRRARRNLSRPRG
    Click to Show/Hide
Function
Specifically methylates the adenosine-1067 in 23S ribosomal RNA. Confers resistance to antibiotic thiostrepton.
    Click to Show/Hide
Uniprot ID
TSNR_STRLU
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces laurentii
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Clinical Trial Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Thiostrepton
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Streptomyces laurentii infection [ICD-11: 1C43.9] [1]
Resistant Disease Streptomyces laurentii infection [ICD-11: 1C43.9]
Resistant Drug Thiostrepton
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain XL-1 Blue MRF 562
Streptomyces laurentii strain 39478
Streptomyces lividans strain Tk24 457428
Experiment for
Molecule Alteration
DNA hybridizations assay
Mechanism Description The Th R (tsnR) gene from SI is highly similar to the Th R and Nh R genes from Saz and Sac. Partial nt sequence analysis of the DNA flanking the Sl tsnR gene indicates that tsnR is clustered with r-protein operons. Insert-directed integration of pkCl132 within this region supports the idea that, in S1, tsnR is not clustered with genes encoding Th biosynthetic enzymes.
Disease Class: Streptomyces lividans infection [ICD-11: 1C43.8] [1]
Resistant Disease Streptomyces lividans infection [ICD-11: 1C43.8]
Resistant Drug Thiostrepton
Molecule Alteration Expression
Acquired
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain XL-1 Blue MRF 562
Streptomyces laurentii strain 39478
Streptomyces lividans strain Tk24 457428
Experiment for
Molecule Alteration
DNA hybridizations assay
Mechanism Description The Th R (tsnR) gene from SI is highly similar to the Th R and Nh R genes from Saz and Sac. Partial nt sequence analysis of the DNA flanking the Sl tsnR gene indicates that tsnR is clustered with r-protein operons. Insert-directed integration of pkCl132 within this region supports the idea that, in S1, tsnR is not clustered with genes encoding Th biosynthetic enzymes.
References
Ref 1 The thiostrepton-resistance-encoding gene in Streptomyces laurentii is located within a cluster of ribosomal protein operons. Gene. 1995 Oct 16;164(1):137-42. doi: 10.1016/0378-1119(95)00442-9.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.