Molecule Information
General Information of the Molecule (ID: Mol00754)
Name |
23S rRNA (adenosine(1067)-2'-O)-methyltransferase (TSNR)
,Streptomyces laurentii
|
||||
---|---|---|---|---|---|
Synonyms |
23S rRNA [AM1067] 2'-O-methyltransferase; 23S rRNA methylase; Thiostrepton-resistance methylase; rRNA (adenosine-2'-O)-methyltransferase
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
tsnR
|
||||
Sequence |
MANLDVIVDRSDPAVQRIVDVTKHSRSVVRTVLIEDIEPLTQSIRAGVEFTEVYGLDTVP
FPGDLLAACEKRGIRVRLLSAAVANQVFKTEKKPKVFGIAKVPPAGRFADLESLSGDVVL LDGVKIVGNIGAIVRTRSALGAAGIVLVDSGLGTIADRRLIRASRGYVFSLPIVLATRDE ALAFFRDGGMRPVVFEADGKLSIGELDGIDERLVLVFGSEKTGPSGEFAGVATESVSIPM NPAAESLNVSVSAGIALHRRARRNLSRPRG Click to Show/Hide
|
||||
Function |
Specifically methylates the adenosine-1067 in 23S ribosomal RNA. Confers resistance to antibiotic thiostrepton.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Clinical Trial Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Streptomyces laurentii infection | [1] | |||
Resistant Disease | Streptomyces laurentii infection [ICD-11: 1C43.9] | |||
Resistant Drug | Thiostrepton | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain XL-1 Blue MRF | 562 | ||
Streptomyces laurentii strain | 39478 | |||
Streptomyces lividans strain Tk24 | 457428 | |||
Experiment for Molecule Alteration |
DNA hybridizations assay | |||
Mechanism Description | The Th R (tsnR) gene from SI is highly similar to the Th R and Nh R genes from Saz and Sac. Partial nt sequence analysis of the DNA flanking the Sl tsnR gene indicates that tsnR is clustered with r-protein operons. Insert-directed integration of pkCl132 within this region supports the idea that, in S1, tsnR is not clustered with genes encoding Th biosynthetic enzymes. | |||
Disease Class: Streptomyces lividans infection | [1] | |||
Resistant Disease | Streptomyces lividans infection [ICD-11: 1C43.8] | |||
Resistant Drug | Thiostrepton | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli strain XL-1 Blue MRF | 562 | ||
Streptomyces laurentii strain | 39478 | |||
Streptomyces lividans strain Tk24 | 457428 | |||
Experiment for Molecule Alteration |
DNA hybridizations assay | |||
Mechanism Description | The Th R (tsnR) gene from SI is highly similar to the Th R and Nh R genes from Saz and Sac. Partial nt sequence analysis of the DNA flanking the Sl tsnR gene indicates that tsnR is clustered with r-protein operons. Insert-directed integration of pkCl132 within this region supports the idea that, in S1, tsnR is not clustered with genes encoding Th biosynthetic enzymes. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.